DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN31

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001128687.1 Gene:ZSCAN31 / 64288 HGNCID:14097 Length:406 Species:Homo sapiens


Alignment Length:391 Identity:103/391 - (26%)
Similarity:159/391 - (40%) Gaps:86/391 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VEAKDDGCWADPLSDAH-EGLKINDAEVEQEVLYEVSYADNEGLEED--------HDLYKKE-EE 135
            |:.::|..|.   .:.| .|...:..|..:::..:..|.:..|..|.        |...:.| ..
Human    13 VKVEEDPIWD---QETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRLRELCHQWLRPEIHT 74

  Fly   136 ESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTGHDDGEES--------QECEE---S 189
            :.::.|....|.....:|    ::.|...:|:..        :.|||:        ||..|   .
Human    75 KEQILELLVLEQFLTILP----EELQAWVREHHP--------ESGEEAVAVVEDLEQELSEPGNQ 127

  Fly   190 QPDEE--ESQQNEEDEEE---SQEDDD-----------------ELWQNEDGDSDTDADSMSDIE 232
            .||.|  .|:...||.|.   .||..|                 ..:|.:||:|..:     :.|
Human   128 APDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPE-----NQE 187

  Fly   233 ATSRQSALDE-----DKKPRR------KYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCG 286
            ..|:|..|.|     |.|.:|      ||  |.:.|.|     ..|:|::.....::.|.|:.||
Human   188 LASKQEILKEMEHLGDSKLQRDVSLDSKY--RETCKRD-----SKAEKQQAHSTGERRHRCNECG 245

  Fly   287 KKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTM 351
            |.||.......|...|:|.||:||.|||:....|..||.| |..|.|||||.|:.|.:.|..|..
Human   246 KSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEH-RRSHTGEKPYQCKECGKAFSASNG 309

  Fly   352 RSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHY 416
            .:|| .|:|..:|.   ::|..|.|.:..:....:|:.:||||:.:.|..|..:|.:|:.|..|.
Human   310 LTRH-RRIHTGEKP---YECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHL 370

  Fly   417 R 417
            |
Human   371 R 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 9/20 (45%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 7/20 (35%)
C2H2 Zn finger 399..417 CDD:275368 6/17 (35%)
ZSCAN31NP_001128687.1 SCAN 35..146 CDD:128708 24/122 (20%)
SCAN 35..123 CDD:280241 16/99 (16%)
COG5048 <156..397 CDD:227381 71/233 (30%)
zf-C2H2 239..261 CDD:278523 8/21 (38%)
C2H2 Zn finger 241..261 CDD:275368 7/19 (37%)
zf-H2C2_2 254..278 CDD:290200 10/23 (43%)
C2H2 Zn finger 269..289 CDD:275368 9/20 (45%)
zf-H2C2_2 281..305 CDD:290200 12/24 (50%)
C2H2 Zn finger 297..317 CDD:275368 7/20 (35%)
zf-H2C2_2 310..332 CDD:290200 8/25 (32%)
C2H2 Zn finger 325..345 CDD:275368 4/19 (21%)
zf-H2C2_2 338..362 CDD:290200 8/23 (35%)
C2H2 Zn finger 353..373 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 3/6 (50%)
C2H2 Zn finger 381..401 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.