DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and CG17359

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:462 Identity:95/462 - (20%)
Similarity:161/462 - (34%) Gaps:150/462 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTPQCRLCGDL------IYTQ---NPVNIFDENSKMVRQIALVTGLWLTDHSKMPRNMCSCCLLS 56
            ::..||:|.|.      |||:   :...:.::...:...:...:|..:.....||:.:|..|..:
  Fly     3 ISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEA 67

  Fly    57 LKSAIAFRQACIKTNN-----RLTIQRRSVEAKDDGCWADPLSDAHEGLKINDAEVEQEVLYEVS 116
            :::|...|:.|.|::.     ||.::.              |.|....|.|.| .:|.::...|.
  Fly    68 VRNAYRLRRQCRKSHQYFEQLRLMMKE--------------LDDIEYCLNIGD-NIEPQMPVSVM 117

  Fly   117 YADNEGLEEDHDLYKKEEEES-----EVNENK----EFEDIACEIPFSKEDDEQEQQQEYEDMVD 172
            .|.            |..|.|     |:.:.|    |.:.|:..:|   :::|.:..|.|.   .
  Fly   118 EAG------------KTPETSEPLLVELVQVKYMPPEPKPISSPLP---DNNEHKLAQSYS---P 164

  Fly   173 KKTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIEATSRQ 237
            .||.|:   :|:....|..|.:..   ..|.|...||||::|                       
  Fly   165 AKTPHN---KSKRRARSYSDNDSW---SPDSELEHEDDDKIW----------------------- 200

  Fly   238 SALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRH 302
                       ..:||..||.      .|...:           |..|.:.||.|.|..:|:..|
  Fly   201 -----------NASKRGKPKR------VPGPYR-----------CKLCTQSFTQKQNLEIHMRIH 237

  Fly   303 SGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPK 367
            :|.:|::|..|.:....:..|..|.|. |.||:|:.|..|.:||     |...:.:||..     
  Fly   238 TGERPYKCSLCPRSFAQKGNLQSHTRC-HTGERPFGCPNCPKRF-----RQVGQLQVHTR----- 291

  Fly   368 NFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRSRQHQNKLIAMSAKS 432
                                  .||||:.|.|..|:.||.:.:.|:.|..:.....:    ...|
  Fly   292 ----------------------THTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKR----RTSS 330

  Fly   433 EIDSKNK 439
            :...:||
  Fly   331 QETKRNK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 16/83 (19%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 5/20 (25%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 0/16 (0%)
zf-met 398..421 CDD:289631 6/22 (27%)
C2H2 Zn finger 399..417 CDD:275368 6/17 (35%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/81 (20%)
zf-C2H2 215..237 CDD:278523 7/32 (22%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 7/24 (29%)
C2H2 Zn finger 245..265 CDD:275368 5/20 (25%)
zf-H2C2_2 257..282 CDD:290200 11/30 (37%)
C2H2 Zn finger 273..293 CDD:275368 7/51 (14%)
zf-H2C2_2 286..310 CDD:290200 11/50 (22%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.