DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZKSCAN4

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_061983.2 Gene:ZKSCAN4 / 387032 HGNCID:13854 Length:545 Species:Homo sapiens


Alignment Length:444 Identity:104/444 - (23%)
Similarity:172/444 - (38%) Gaps:127/444 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CCLLSLKSAIAFRQACIKTNNRLTIQRRSVEA--KDDGCWADPLSD--------AHEGLKINDAE 106
            ||.::|.:         :|....:.|.:.::|  |.:...:.||.|        |..|....||.
Human   153 CCKMALLT---------QTQGSQSSQCQPMKALFKHESLGSQPLHDRVLQVPGLAQGGCCREDAM 208

  Fly   107 VEQEVLYEVSYADNEGLEEDHD------------------LYKKEEEE---SEVNENKEFEDIAC 150
            |...:.     ..::||.:..|                  ||:.|::|   |.|:...|.:..:.
Human   209 VASRLT-----PGSQGLLKMEDVALTLTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEIQTKSR 268

  Fly   151 EIPFSKEDDEQEQQQ---EYEDMVDKKTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDE 212
            ::|..|:..|:|..:   ..||:....|..:.||:....:..|.:...|:::             
Human   269 DLPPVKKLPEKEHGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRH------------- 320

  Fly   213 LWQNEDGDSDTDADSMSDIEATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYIS- 276
             :.:|.|.|...:..::               |.||.:|.....:.:|..         ||:|. 
Human   321 -YCHECGKSFAQSSGLT---------------KHRRIHTGEKPYECEDCG---------KTFIGS 360

  Fly   277 ------QKVHI------CDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRV 329
                  |:||.      |:.|||.|:...|...|...|:|.||:||.:|| |.|::....:....
Human   361 SALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCG-KTFSQSCSLLEHHK 424

  Fly   330 KHRGEKPYACQFCDERFVHSTMRSRHENRVH------------------------RNKKTPKNFK 370
            .|.|||||.|..|.:.|..::...||: |:|                        .|.:.|.::|
Human   425 IHTGEKPYQCNMCGKAFRRNSHLLRHQ-RIHGDKNVQNPEHGESWESQGRTESQWENTEAPVSYK 488

  Fly   371 CNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRSRQHQNK 424
            ||.|::.:..|....:|:.:||||:.:.|:.|...|||.|.|..|.||  |..|
Human   489 CNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRS--HVGK 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 4/21 (19%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 5/20 (25%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 10/22 (45%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZKSCAN4NP_061983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
SCAN 49..160 CDD:128708 3/6 (50%)
KRAB 221..281 CDD:214630 11/59 (19%)
zf-C2H2 320..342 CDD:306579 6/50 (12%)
C2H2 Zn finger 322..342 CDD:275368 6/34 (18%)
zf-H2C2_2 335..357 CDD:316026 6/45 (13%)
C2H2 Zn finger 350..370 CDD:275368 5/28 (18%)
COG5048 <374..544 CDD:227381 54/171 (32%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 5/20 (25%)
C2H2 Zn finger 434..454 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..480 0/24 (0%)
C2H2 Zn finger 489..509 CDD:275368 5/19 (26%)
C2H2 Zn finger 517..537 CDD:275368 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.