DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN5B

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001073925.2 Gene:ZSCAN5B / 342933 HGNCID:34246 Length:495 Species:Homo sapiens


Alignment Length:390 Identity:93/390 - (23%)
Similarity:149/390 - (38%) Gaps:87/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NNRLTIQRRSVEAKDD-----GCWADPLSDAHEGLKINDAEVEQEVLYEV-SYADNEGLEEDHDL 129
            |:.:.:.......:||     ..||..::..|.|  ...|..||::|..| :.:..:|  ||..|
Human   142 NSDVEMAEAPASVRDDPRDVSSQWASSVNQMHPG--TGQARREQQILPRVAALSRRQG--EDFLL 202

  Fly   130 YK-------------KEEEESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTGHDDGE 181
            :|             |:..|.::.||:| |:.....|       :.|..:..::|..|.|     
Human   203 HKSIDVTGDPNSPRPKQTLEKDLKENRE-ENPGLSSP-------EPQLPKSPNLVRAKEG----- 254

  Fly   182 ESQECEESQPDEEESQQNEEDEEESQ---EDDDELWQNEDGD---------SDTDADSMSDIEAT 234
                   .:|.:..|.:|.:.:..|.   |.:........||         |..||.|:|..|..
Human   255 -------KEPQKRASVENVDADTPSACVVEREALTHSGNRGDALNLSSPKRSKPDASSISQEEPQ 312

  Fly   235 SRQSALDEDKKPRRKYTKR----------SSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKF 289
            ...:.:...:.|.:.....          |.|...:...|.|             ..||.|.|.|
Human   313 GEATPVGNRESPGQAEINPVHSPGPAGPVSHPDGQEAKALPP-------------FACDVCNKSF 364

  Fly   290 TDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSR 354
            ......::|...|:|.:||:|..|.::......|.:|.|| |.||:||.|..|.:||.|.:....
Human   365 KYFSQLSIHRRSHTGDRPFQCDLCRKRFLQPSDLRVHQRV-HTGERPYMCDVCQKRFAHESTLQG 428

  Fly   355 HENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSF----TRNSNLKTH 415
            |: |:|..::.   |||.||.|.:........|:..|:||:.:.|..|:.:|    |...:||||
Human   429 HK-RIHTGERP---FKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQLGTFKRHLKTH 489

  Fly   416  415
            Human   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 1/2 (50%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 6/20 (30%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 8/22 (36%)
C2H2 Zn finger 399..417 CDD:275368 8/21 (38%)
ZSCAN5BNP_001073925.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
SCAN 40..124 CDD:153421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..183 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..347 25/139 (18%)
zf-C2H2 355..377 CDD:395048 6/21 (29%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:404364 7/23 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
C2H2 Zn finger 413..433 CDD:275368 7/20 (35%)
zf-H2C2_2 426..450 CDD:404364 9/27 (33%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-H2C2_2 453..478 CDD:404364 7/24 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.