DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF517

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001371833.1 Gene:ZNF517 / 340385 HGNCID:27984 Length:492 Species:Homo sapiens


Alignment Length:166 Identity:50/166 - (30%)
Similarity:75/166 - (45%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 KTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKP 336
            :.:..::.:.|..|||.|:.......|...|:|.|||.|.|||:....|:.||.|.|: |.||:|
Human   253 RVHTRERPYACGECGKAFSRSSRLLQHQKFHTGEKPFACTECGKAFCRRFTLNEHGRI-HSGERP 316

  Fly   337 YACQFCDERFVHSTMRSRHENRVH--------------------RNKKTPKNFKCNYCDKRYESN 381
            |.|..|.:||:..:...:| :|:|                    |.:......:|..|.:.:..|
Human   317 YRCLRCGQRFIRGSSLLKH-HRLHAQEGAQDGGVGQGALLGAAQRPQAGDPPHECPVCGRPFRHN 380

  Fly   382 YQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYR 417
            .....|..:||||:.|.|..|..:|.|.|||..|.:
Human   381 SLLLLHLRLHTGEKPFECAECGKAFGRKSNLTLHQK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 9/20 (45%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 8/20 (40%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZNF517NP_001371833.1 KRAB 14..73 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..170
C2H2 Zn finger 180..199 CDD:275368
COG5048 <203..342 CDD:227381 32/90 (36%)
C2H2 Zn finger 207..227 CDD:275368
C2H2 Zn finger 235..255 CDD:275368 0/1 (0%)
C2H2 Zn finger 263..283 CDD:275368 6/19 (32%)
COG5048 <287..459 CDD:227381 42/132 (32%)
C2H2 Zn finger 291..311 CDD:275368 9/20 (45%)
C2H2 Zn finger 319..339 CDD:275368 6/20 (30%)
C2H2 Zn finger 370..390 CDD:275368 4/19 (21%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..446 CDD:275368
C2H2 Zn finger 454..474 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.