DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF621

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001091884.1 Gene:ZNF621 / 285268 HGNCID:24787 Length:439 Species:Homo sapiens


Alignment Length:154 Identity:49/154 - (31%)
Similarity:75/154 - (48%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 KKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRG 333
            :.:.::..:|...|..|||.|....:..:|...|.|..|:||.|||:...:...|..|.|: |.|
Human   168 RHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGEGPYECKECGKGLSSNTALTQHQRI-HTG 231

  Fly   334 EKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFH 398
            ||||.|:.|.:.|..|....:|: |:|..:|.   :||..|.|.:........|:.:||||:.:.
Human   232 EKPYECKECGKAFRRSAAYLQHQ-RLHTGEKL---YKCKECWKAFGCRSLFIVHQRIHTGEKPYQ 292

  Fly   399 CEVCKVSFTRNSNLKTHYRSRQHQ 422
            |:.|..:||:.      ..|.|||
Human   293 CKECGKAFTQK------IASIQHQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 5/22 (23%)
C2H2 Zn finger 399..417 CDD:275368 4/17 (24%)
ZNF621NP_001091884.1 KRAB 11..71 CDD:214630
COG4049 145..198 CDD:226535 6/29 (21%)
C2H2 Zn finger 153..173 CDD:275368 0/4 (0%)
zf-H2C2_2 166..190 CDD:316026 6/21 (29%)
C2H2 Zn finger 209..229 CDD:275368 7/20 (35%)
zf-H2C2_2 221..246 CDD:316026 12/25 (48%)
C2H2 Zn finger 237..257 CDD:275368 6/20 (30%)
C2H2 Zn finger 265..285 CDD:275368 4/19 (21%)
zf-H2C2_2 281..302 CDD:316026 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 8/24 (33%)
zf-H2C2_2 308..329 CDD:316026 3/3 (100%)
C2H2 Zn finger 321..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.