DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN1

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_006723212.1 Gene:ZSCAN1 / 284312 HGNCID:23712 Length:448 Species:Homo sapiens


Alignment Length:304 Identity:63/304 - (20%)
Similarity:100/304 - (32%) Gaps:98/304 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 DDEQEQQQEYEDMVDKKTGHDDGEESQECE---------ESQPDEEE------SQQNEEDEEESQ 207
            |..:.|...:.:..|.|:.....|.||..|         .:.|:|.|      .||:.....|::
Human   169 DSVEPQDWSFGEEEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAE 233

  Fly   208 ED--------------DDELWQNEDGDSDTDADSMSDIEATSRQSALDEDKKPRRKYTKRSSPKN 258
            ..              ...:|   |...|..|...||:.|..               |..||||.
Human   234 APRAPGLLGSRARLPLKPSIW---DEPEDLLAGPSSDLRAEG---------------TVISSPKG 280

  Fly   259 DDTDFLKPAKKKRKTYISQKVHICDHCGK-----KFTDKGN----FNLHVLRHS--GVKPFECPE 312
            .....:.|.::.|.|         |..|:     |.|..|.    ..:.|:...  |.:||:|.:
Human   281 PSAQRISPRRRNRNT---------DQSGRHQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCAD 336

  Fly   313 CGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVH----RNKKTPKN----- 368
            ||. .|......|..:..||.|.|:.|..|.:.|:|:::.:.| .::|    ..||.|::     
Human   337 CGM-VFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEH-GKIHLLEPPRKKAPRSKGPRE 399

  Fly   369 --------------------FKCNYCDKRYESNYQRAKHEVVHT 392
                                |:|:.|.|.:........|:.:||
Human   400 SVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHT 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/28 (21%)
C2H2 Zn finger 310..331 CDD:275368 5/20 (25%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631
C2H2 Zn finger 399..417 CDD:275368
ZSCAN1XP_006723212.1 SCAN 75..162 CDD:280241
C2H2 Zn finger 334..354 CDD:275368 5/20 (25%)
zf-H2C2_2 346..371 CDD:290200 8/24 (33%)
C2H2 Zn finger 362..382 CDD:275368 5/20 (25%)
C2H2 Zn finger 422..442 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.