DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF584

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_775819.1 Gene:ZNF584 / 201514 HGNCID:27318 Length:421 Species:Homo sapiens


Alignment Length:347 Identity:92/347 - (26%)
Similarity:144/347 - (41%) Gaps:74/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EDHDLYKKEEEESEVNENKE--FEDIACE----------------IPFSKEDDEQEQQQEYEDM- 170
            ||..:|...||...:|..::  :.|:..|                :....|||||.....:.|: 
Human    20 EDVTVYFSREEWGLLNVTQKGLYRDVMLENFALVSSLGLAPSRSPVFTQLEDDEQSWVPSWVDVT 84

  Fly   171 ------------------VDKKTGHDDGEESQECEESQPDEEESQQNEEDEE-----------ES 206
                              |:.:..|.:..:|....:.|....|.:.....|.           :.
Human    85 PVSRAEARRGFGLDGLCRVEDERAHPEHLKSYRVIQHQDTHSEGKPRRHTEHGAAFPPGSSCGQQ 149

  Fly   207 QEDD--DELWQNED-GDSDTDADSMSDIEATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAK 268
            ||..  ::|::..| |.....|.::.|...|      ..:::|.|..|.||:       |.|.|.
Human   150 QEVHVAEKLFKCSDCGKVFLKAFALLDHLIT------HSEERPFRCPTGRSA-------FKKSAH 201

  Fly   269 -KKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRY-ILNIHIRVKH 331
             ..||.:..:..|:|:.|||.|:.......|...|:|:|||:|.:|| |.|||. .|.:|.|: |
Human   202 INPRKIHTGETAHVCNECGKAFSYPSKLRKHQKVHTGIKPFKCSDCG-KTFNRKDALVLHQRI-H 264

  Fly   332 RGEKPYACQFCDERF-VHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGER 395
            .||:||.|..|.:.| |.||: .|| .:||..::.   ::|..|.|.::.|.....|:.||||||
Human   265 TGERPYECSKCGKTFSVLSTL-IRH-RKVHIGERP---YECTECGKFFKYNNSFILHQRVHTGER 324

  Fly   396 NFHCEVCKVSFTRNSNLKTHYR 417
            .|.|:.|...:...|.|..|::
Human   325 PFECKQCGKGYVTRSGLYQHWK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 10/21 (48%)
C2H2 Zn finger 339..360 CDD:275368 8/21 (38%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 5/20 (25%)
C2H2 Zn finger 399..417 CDD:275368 5/17 (29%)
ZNF584NP_775819.1 KRAB 17..77 CDD:214630 13/56 (23%)
KRAB 17..56 CDD:279668 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..146 3/25 (12%)
C2H2 Zn finger 161..181 CDD:275368 5/25 (20%)
COG5048 <189..374 CDD:227381 62/172 (36%)
zf-C2H2 214..236 CDD:278523 7/21 (33%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
zf-H2C2_2 229..253 CDD:290200 11/24 (46%)
C2H2 Zn finger 244..264 CDD:275368 10/21 (48%)
zf-H2C2_2 256..280 CDD:290200 10/24 (42%)
C2H2 Zn finger 272..292 CDD:275368 8/21 (38%)
zf-H2C2_2 285..309 CDD:290200 7/28 (25%)
C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
zf-H2C2_2 316..337 CDD:290200 10/20 (50%)
C2H2 Zn finger 328..348 CDD:275368 5/19 (26%)
C2H2 Zn finger 356..376 CDD:275368
zf-H2C2_2 370..393 CDD:290200
C2H2 Zn finger 384..404 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.