DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and klf-3

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:133 Identity:41/133 - (30%)
Similarity:58/133 - (43%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DIEATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDH--CGKKFTDK 292
            |...:|..|....::.|.::.::..|.|.:.||         |.::   ||.|.:  |.||::..
 Worm   192 DSTRSSPSSTTSSERSPLQRKSRIESNKRNPTD---------KKFV---VHACTYPGCFKKYSKS 244

  Fly   293 GNFNLHVLRHSGVKPFEC--PECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRH 355
            .:...|...|||.|||.|  ..|..|......|..|:| ||.|:||:.|..||..|..|...|.|
 Worm   245 SHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMR-KHTGDKPFRCSLCDRNFARSDHLSLH 308

  Fly   356 ENR 358
            ..|
 Worm   309 MKR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 5/21 (24%)
C2H2 Zn finger 310..331 CDD:275368 6/22 (27%)
C2H2 Zn finger 339..360 CDD:275368 8/20 (40%)
C2H2 Zn finger 371..388 CDD:275370
zf-met 398..421 CDD:289631
C2H2 Zn finger 399..417 CDD:275368
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 4/18 (22%)
C2H2 Zn finger 262..284 CDD:275368 6/22 (27%)
zf-H2C2_2 276..301 CDD:290200 12/25 (48%)
C2H2 Zn finger 292..312 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.