Sequence 1: | NP_650659.2 | Gene: | CG17802 / 42143 | FlyBaseID: | FBgn0038549 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001251370.1 | Gene: | blmp-1 / 172917 | WormBaseID: | WBGene00003847 | Length: | 817 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 56/199 - (28%) |
---|---|---|---|
Similarity: | 90/199 - (45%) | Gaps: | 24/199 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 YTKRSSPKNDDTDFLKPAKKKRKTYISQKV-----HICDHCGKKFTDKGNFNLHVLRHSGVKPFE 309
Fly 310 CPECGQKEFNRYI-LNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNY 373
Fly 374 CDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRSRQHQNKLI-------AMSAK 431
Fly 432 SEID 435 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17802 | NP_650659.2 | zf-AD | 4..74 | CDD:285071 | |
C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 310..331 | CDD:275368 | 7/21 (33%) | ||
C2H2 Zn finger | 339..360 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 371..388 | CDD:275370 | 3/16 (19%) | ||
zf-met | 398..421 | CDD:289631 | 6/22 (27%) | ||
C2H2 Zn finger | 399..417 | CDD:275368 | 6/17 (35%) | ||
blmp-1 | NP_001251370.1 | SET | 119..247 | CDD:214614 | |
zf-C2H2 | 508..530 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 510..530 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 522..547 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 538..558 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 550..575 | CDD:290200 | 11/26 (42%) | ||
C2H2 Zn finger | 566..586 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 578..603 | CDD:290200 | 6/27 (22%) | ||
C2H2 Zn finger | 594..614 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 606..631 | CDD:290200 | 6/24 (25%) | ||
ARS2 | <620..772 | CDD:282772 | 11/46 (24%) | ||
C2H2 Zn finger | 622..641 | CDD:275368 | 6/18 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |