Sequence 1: | NP_650659.2 | Gene: | CG17802 / 42143 | FlyBaseID: | FBgn0038549 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_597721.2 | Gene: | ZNF483 / 158399 | HGNCID: | 23384 | Length: | 744 | Species: | Homo sapiens |
Alignment Length: | 391 | Identity: | 88/391 - (22%) |
---|---|---|---|
Similarity: | 153/391 - (39%) | Gaps: | 116/391 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 EEDHDLYKK-----EEEESEVNENKEFEDIACEIPFS---------KEDDEQEQQQEYEDMVDKK 174
Fly 175 TGHDD-------------GEESQE---------------------CEESQPDE-EESQQNEEDEE 204
Fly 205 ESQEDDDELWQ--------------------------NEDGDSDTDADSMSDIEATS-------- 235
Fly 236 --------------RQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCG 286
Fly 287 KKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTM 351
Fly 352 RSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHY 416
Fly 417 R 417 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17802 | NP_650659.2 | zf-AD | 4..74 | CDD:285071 | |
C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 310..331 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 339..360 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 371..388 | CDD:275370 | 4/16 (25%) | ||
zf-met | 398..421 | CDD:289631 | 8/20 (40%) | ||
C2H2 Zn finger | 399..417 | CDD:275368 | 7/17 (41%) | ||
ZNF483 | NP_597721.2 | SCAN | 49..152 | CDD:128708 | |
SCAN | 49..136 | CDD:280241 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 137..156 | ||||
KRAB | 171..229 | CDD:214630 | |||
KRAB | 171..209 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 263..308 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 350..385 | 6/35 (17%) | |||
C2H2 Zn finger | 361..384 | CDD:275368 | 3/23 (13%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 5/19 (26%) | ||
COG5048 | 437..>735 | CDD:227381 | 61/257 (24%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 453..477 | CDD:290200 | 3/23 (13%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 485..505 | CDD:290200 | 1/19 (5%) | ||
C2H2 Zn finger | 497..517 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 509..533 | CDD:290200 | 4/24 (17%) | ||
zf-C2H2 | 523..545 | CDD:278523 | 3/25 (12%) | ||
C2H2 Zn finger | 525..545 | CDD:275368 | 2/23 (9%) | ||
zf-C2H2 | 579..601 | CDD:278523 | 7/22 (32%) | ||
C2H2 Zn finger | 581..601 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 594..618 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 609..629 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 625..644 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 637..657 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 650..674 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 665..685 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 677..702 | CDD:290200 | 3/7 (43%) | ||
C2H2 Zn finger | 693..713 | CDD:275368 | |||
zf-H2C2_2 | 706..730 | CDD:290200 | |||
C2H2 Zn finger | 721..741 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |