DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF582

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001307300.2 Gene:ZNF582 / 147948 HGNCID:26421 Length:517 Species:Homo sapiens


Alignment Length:367 Identity:91/367 - (24%)
Similarity:144/367 - (39%) Gaps:94/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 EVSYADNEGLEEDHDLYKKEEEESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTGHD 178
            |..|...|...:.| :|:.|..:.|:.|:.....:.|.   |.:||     .|..:..|::.|:.
Human    80 ESRYDTKELFPKQH-VYEVESPQWEIMESLTSYGLECS---SFQDD-----WECRNQFDRQQGNP 135

  Fly   179 DGEESQEC--EESQP--DEEES---QQNEEDEEES---QEDDDELWQNEDGDSDTDADSMSDIEA 233
            |....|..  .|..|  |:..|   .|.....|:.   .:...:.||.               |.
Human   136 DRHFHQMIIRHEEMPTFDQHASLTFYQKIHTREKPFGYNKCRKDFWQK---------------EL 185

  Fly   234 TSRQSALDEDKKPRR--------KYTKR--------SSPK-----------NDDTDFLKPAKKKR 271
            ......:..::||.:        ||..|        |..|           |..::|:    :.:
Human   186 LINHQGIYTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGSNFI----QHQ 246

  Fly   272 KTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYI-LNIHIRVKHRGEK 335
            :.:..:|.:.|..|.|.|:.......|...|:|.||::|.||| |.|||.. |.:|.|: |.|||
Human   247 RVHTGEKPYECKDCEKAFSRSSQLIEHQRTHTGEKPYQCKECG-KAFNRISHLKVHYRI-HTGEK 309

  Fly   336 PYACQFCDERFVHSTMRSRHENRVHRNKKT-------------------------PKNFKCNYCD 375
            ||||:.|.:.|.|.:...:|:. ||..:|.                         .|.::|..|.
Human   310 PYACKECGKTFSHRSQLIQHQT-VHTGRKLYECKECGKAFNQGSTLIRHQRIHTGEKPYECKVCG 373

  Fly   376 KRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYR 417
            |.:..:.|..:|:.:||||:.:.|:||..:|.|.|:|..|||
Human   374 KAFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
C2H2 Zn finger 310..331 CDD:275368 11/21 (52%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 10/20 (50%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZNF582NP_001307300.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.