DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZFP92

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001129745.1 Gene:ZFP92 / 139735 HGNCID:12865 Length:416 Species:Homo sapiens


Alignment Length:146 Identity:56/146 - (38%)
Similarity:83/146 - (56%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 SQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNR-YILNIHIRVKHRGEKPYAC 339
            ::|.::|..|||.|:...|...|.:.|||.||:.||||| |.|.| :.|..|.|: |.|||||||
Human   148 AEKRYLCQQCGKAFSRSSNLIKHRIIHSGEKPYACPECG-KLFRRSFALLEHQRI-HSGEKPYAC 210

  Fly   340 QFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKV 404
            ..|.:.|..|:...:|: .:|..::.   |.|..|.|.:..::...:|..||:|||.:.|..|..
Human   211 PECSKTFTRSSNLIKHQ-VIHSGERP---FACGDCGKLFRRSFALLEHARVHSGERPYACPECGK 271

  Fly   405 SFTRNSNLKTHYRSRQ 420
            :|:|:|||..|.|:.:
Human   272 AFSRSSNLIEHQRTHR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..331 CDD:275368 11/21 (52%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 9/23 (39%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZFP92NP_001129745.1 KRAB 14..74 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..125
COG5048 <145..286 CDD:227381 56/143 (39%)
C2H2 Zn finger 154..174 CDD:275368 7/19 (37%)
C2H2 Zn finger 182..202 CDD:275368 11/21 (52%)
C2H2 Zn finger 210..230 CDD:275368 5/20 (25%)
C2H2 Zn finger 238..258 CDD:275368 4/19 (21%)
COG5048 262..>315 CDD:227381 10/26 (38%)
C2H2 Zn finger 266..286 CDD:275368 9/19 (47%)
C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 322..342 CDD:275368
zf-H2C2_2 335..359 CDD:404364
C2H2 Zn finger 350..370 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.