DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF554

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001096121.1 Gene:ZNF554 / 115196 HGNCID:26629 Length:538 Species:Homo sapiens


Alignment Length:498 Identity:102/498 - (20%)
Similarity:184/498 - (36%) Gaps:144/498 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CGDLIYTQNPVNIFDENSKMVRQIALVTG-----------------LWLTDHSKMPRNMCSCCLL 55
            |.|:...:.|::  ...:..|..::..||                 ||: :....|:..||..:.
Human    91 CTDVGIKEGPLS--PAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWI-EEKGTPQASCSDWMT 152

  Fly    56 SLKSAIAFRQACIKTNNRLTIQRRSVEA-------KDDGCWADPLSDAHEGLKINDAEVEQEVLY 113
            .|::..:       |..::.:|......       ::||.|.. |.|:||               
Human   153 VLRNQDS-------TYKKVALQEEPASGINMIKLIREDGGWKQ-LEDSHE--------------- 194

  Fly   114 EVSYADNEGLEED----HDLYKKEEEESEVNENKEFEDIACEIPFSKEDDEQEQQQEYEDMVDKK 174
                 |.:||...    |.:...:|:.:..:...|..:::..:..|:.              ..|
Human   195 -----DPQGLLSQKASLHVVAVPQEKATAWHGFGENGNLSPALVLSQG--------------SSK 240

  Fly   175 TGHDDGEE---SQECEESQPDEEESQQNEEDEEESQEDDDELWQN--------------EDGDSD 222
            ..|..|.|   :....:|..:..:....:....||.|..:.:.||              |:|   
Human   241 GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVYLENG--- 302

  Fly   223 TDADSMSDIEATSRQSALDEDKKP------RRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHI 281
               .|::...|.:..:.::..:||      .:.:.:|.|           ..:.::.:..:|.:.
Human   303 ---QSLNHGMALTIHNKINTAEKPFECHQCGKVFNRRHS-----------LSEHQRIHTGEKPYE 353

  Fly   282 CDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRY-ILNIHIRVKHRGEKPYACQFCDER 345
            |..||:.||.......|:..|:|.||:.|.||| |.|||. .|..|.|: |.|||||.|:.|.:.
Human   354 CQECGRAFTHSSTLTRHLRTHTGEKPYGCGECG-KAFNRISSLTQHQRI-HTGEKPYKCEDCGKS 416

  Fly   346 FVHSTMRSRHENRVHRNKK------------------------TPKN-FKCNYCDKRYESNYQRA 385
            |..|:....|: |.|..:|                        |.:| ::|..|.:.:.......
Human   417 FCQSSYLILHK-RTHTGEKPYECSECGKAFSDRSSLNQHERTHTGENPYECKQCGRAFSQRSSLV 480

  Fly   386 KHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRSRQHQN--KLI 426
            :||..||||:.:.|:.|..:|:::|:|.||.::...|.  |:|
Human   481 RHERTHTGEKPYRCQECGKAFSQSSSLVTHQKTHSSQKTYKII 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 13/82 (16%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 11/21 (52%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 2/16 (13%)
zf-met 398..421 CDD:289631 7/22 (32%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
ZNF554NP_001096121.1 KRAB 44..84 CDD:307490
COG5048 <225..417 CDD:227381 49/224 (22%)
C2H2 Zn finger 276..291 CDD:275368 3/14 (21%)
C2H2 Zn finger 293..318 CDD:275368 4/30 (13%)
zf-C2H2 324..346 CDD:306579 2/32 (6%)
C2H2 Zn finger 326..346 CDD:275368 2/30 (7%)
COG5048 <350..532 CDD:227381 56/177 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
C2H2 Zn finger 382..402 CDD:275368 11/21 (52%)
C2H2 Zn finger 410..430 CDD:275368 6/20 (30%)
C2H2 Zn finger 438..458 CDD:275368 0/19 (0%)
C2H2 Zn finger 466..486 CDD:275368 4/19 (21%)
C2H2 Zn finger 494..514 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.