DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZNF460

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_006626.3 Gene:ZNF460 / 10794 HGNCID:21628 Length:562 Species:Homo sapiens


Alignment Length:397 Identity:93/397 - (23%)
Similarity:132/397 - (33%) Gaps:142/397 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DPLSD--------AHEGLKINDAEVEQEVLYEVSYAD------------NEGLEEDHDLYKKEEE 135
            ||.|:        .||||...|......:..:||..|            :..:.|..:.||.|| 
Human   112 DPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEE- 175

  Fly   136 ESEVNEN-------------KEFEDIACEIPFSKEDDEQEQQQEYEDMVDKKTGHDDGEESQECE 187
              ..|||             |.::...|...|.|.          :.::.....| .||:..:|.
Human   176 --MFNENCFLVQHEQILPRVKPYDCPECGKAFGKS----------KHLLQHHIIH-TGEKPYKCL 227

  Fly   188 ESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIEATSRQSALDEDKKPRRKYTK 252
            |...|                                         .:|:|.|          |:
Human   228 ECGKD-----------------------------------------FNRRSHL----------TR 241

  Fly   253 RSSPKNDDTDFL-----------KPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVK 306
            .....|.|..|:           ....:.::.:..:|..:|:.|||.||.:.||.||...|:..|
Human   242 HQRTHNGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKPFVCNECGKAFTYRSNFVLHNKSHNEKK 306

  Fly   307 PFECPECGQ---------------------------KEFN-RYILNIHIRVKHRGEKPYACQFCD 343
            ||.|.|||:                           |.|| |..|..|.|: |.||||:.|..|.
Human   307 PFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAFNCRSHLKQHERI-HTGEKPFVCSQCG 370

  Fly   344 ERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTR 408
            :.|.|.:....|| |.|..:|.   |:|..|.|.:.......:|..:||||:.:.|..|..:|||
Human   371 KAFTHYSTYVLHE-RAHTGEKP---FECKECGKAFSIRKDLIRHFNIHTGEKPYECLQCGKAFTR 431

  Fly   409 NSNLKTH 415
            .|.|..|
Human   432 MSGLTRH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 10/19 (53%)
C2H2 Zn finger 310..331 CDD:275368 11/48 (23%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 3/16 (19%)
zf-met 398..421 CDD:289631 8/18 (44%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)
ZNF460NP_006626.3 KRAB 12..53 CDD:307490
C2H2 Zn finger 198..218 CDD:275368 3/29 (10%)
COG5048 222..552 CDD:227381 67/273 (25%)
C2H2 Zn finger 226..246 CDD:275368 7/70 (10%)
C2H2 Zn finger 254..274 CDD:275368 0/19 (0%)
C2H2 Zn finger 282..302 CDD:275368 10/19 (53%)
C2H2 Zn finger 310..330 CDD:275368 4/19 (21%)
C2H2 Zn finger 338..358 CDD:275368 7/20 (35%)
C2H2 Zn finger 366..386 CDD:275368 7/20 (35%)
C2H2 Zn finger 394..414 CDD:275368 4/19 (21%)
C2H2 Zn finger 422..442 CDD:275368 8/17 (47%)
C2H2 Zn finger 450..470 CDD:275368
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 506..526 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.