DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and Zfp518b

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001074613.2 Gene:Zfp518b / 100515 MGIID:2140750 Length:1082 Species:Mus musculus


Alignment Length:243 Identity:54/243 - (22%)
Similarity:88/243 - (36%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 QQQEYEDMVDK--KTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDA 225
            |.:|.:|:.::  .|..:.|..|......||       |.....|.||....|:|.    |:.:|
Mouse     2 QIREMKDIGEQLYTTQVNGGPSSLTMSPKQP-------NRATRTERQEAQTLLYQG----SEAEA 55

  Fly   226 DSMS-----DIEATSRQSALDEDKKPRR--------KYTKRSSP---------------KNDDTD 262
            .:|:     ..::..:....|..|.|.:        |.:.|:.|               :|:...
Mouse    56 ATMTIATCVQCKSVHKIPTQDLRKGPGQSQDTYVCFKCSLRAVPTQLHFVNNNAGAAHVRNETET 120

  Fly   263 FLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECG-----QKEFNRYI 322
            ...|..|.:........:.||.|.....|...:..|.|:|..:: |.|..|.     :.||.|::
Mouse   121 ISSPVNKFKVRNFKPGKYYCDKCRFSTKDPLQYRKHTLQHEEIR-FICSHCSYISYTKGEFQRHL 184

  Fly   323 LNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFK 370
                  |||.|..||.|::||...:.:....:|..|||......:.||
Mouse   185 ------VKHTGIFPYRCEYCDYGAIRNDYIVKHRRRVHERAGAKRPFK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 6/25 (24%)
C2H2 Zn finger 339..360 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..388 CDD:275370 54/243 (22%)
zf-met 398..421 CDD:289631
C2H2 Zn finger 399..417 CDD:275368
Zfp518bNP_001074613.2 C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
zf-H2C2_5 167..189 CDD:372805 8/27 (30%)
C2H2 Zn finger 167..187 CDD:275368 6/25 (24%)
C2H2 Zn finger 195..216 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8154
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.