Sequence 1: | NP_650659.2 | Gene: | CG17802 / 42143 | FlyBaseID: | FBgn0038549 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074613.2 | Gene: | Zfp518b / 100515 | MGIID: | 2140750 | Length: | 1082 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 54/243 - (22%) |
---|---|---|---|
Similarity: | 88/243 - (36%) | Gaps: | 53/243 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 QQQEYEDMVDK--KTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDA 225
Fly 226 DSMS-----DIEATSRQSALDEDKKPRR--------KYTKRSSP---------------KNDDTD 262
Fly 263 FLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECG-----QKEFNRYI 322
Fly 323 LNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFK 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17802 | NP_650659.2 | zf-AD | 4..74 | CDD:285071 | |
C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 310..331 | CDD:275368 | 6/25 (24%) | ||
C2H2 Zn finger | 339..360 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 371..388 | CDD:275370 | 54/243 (22%) | ||
zf-met | 398..421 | CDD:289631 | |||
C2H2 Zn finger | 399..417 | CDD:275368 | |||
Zfp518b | NP_001074613.2 | C2H2 Zn finger | 140..160 | CDD:275368 | 6/19 (32%) |
zf-H2C2_5 | 167..189 | CDD:372805 | 8/27 (30%) | ||
C2H2 Zn finger | 167..187 | CDD:275368 | 6/25 (24%) | ||
C2H2 Zn finger | 195..216 | CDD:275368 | 5/20 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8154 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |