DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17802 and ZSCAN30

DIOPT Version :9

Sequence 1:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:485 Identity:102/485 - (21%)
Similarity:181/485 - (37%) Gaps:100/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VNIFDENSKMVRQIALVTGLWLTD------------HSKMPRNMCS-----CC------------ 53
            |.:.:||..:.:...|....|..:            .|..||...|     ||            
Human    22 VKVEEENYVLDQDFGLQENPWSQEVFRQKFRQFSYSDSTGPREALSRLRELCCQWLRPEVHSKEQ 86

  Fly    54 ---LLSLKSAIAF----RQACIKTNNRLTIQRRSVEAKDDGCWADPLSDAHEGLKINDAEVEQEV 111
               ||.|:..:|.    .||.::       :.|....::.....:.|....|..:..|....||:
Human    87 ILELLMLEQFLAILPEELQAWLR-------EHRPENGEEAVTMLEELEKELEEPRQQDTTHGQEM 144

  Fly   112 LYE--------VSYADNEGLEEDHDLYKKEEEESEVNENKEFEDIACEIPFSKED---------- 158
            .::        .|.:.|..::...:..|.|.:||:..:.::...:|.::..:|::          
Human   145 FWQEMTSTGALKSLSLNSPVQPLENQCKTETQESQAFQERDGRMVAGKVLMAKQEIVECVASAAM 209

  Fly   159 -------DEQEQQQEYE------DMVDKKTGHDDGEE-----SQECEESQPDEEESQQNEEDEEE 205
                   .|...|:..|      |...|:.|:..|.:     ||:...|..........|....|
Human   210 ISPGKLPGETHSQRIAEEALGGLDNSKKQKGNAAGNKISQLPSQDRHFSLATFNRRIPTEHSVLE 274

  Fly   206 SQEDDDELWQNEDGDSDTDADSMSDI-------EATSRQSALDEDKK---PRRKYTKRSSPK--N 258
            |.|.:.....|.:..:....|:...:       :|..:.|.|...::   ..|.|..:...|  :
Human   275 SHESEGSFSMNSNDITQQSVDTREKLYECFDCGKAFCQSSKLIRHQRIHTGERPYACKECGKAFS 339

  Fly   259 DDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYIL 323
            ..:|.:    :.::.:..:|.:.|..|||.|........|...|:|.||:||.||| |.|:|...
Human   340 LSSDLV----RHQRIHSGEKPYECCECGKAFRGSSELIRHRRIHTGEKPYECGECG-KAFSRSSA 399

  Fly   324 NIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHE 388
            .|..:..|.|:|.|.|..|.:.|..|::...|: |:|..:|.   ::||.|.|.:..:....:|:
Human   400 LIQHKKIHTGDKSYECIACGKAFGRSSILIEHQ-RIHTGEKP---YECNECGKSFNQSSALTQHQ 460

  Fly   389 VVHTGERNFHCEVCKVSFTRNSNLKTHYRS 418
            .:||||:.:.|..|:.:|...|.|..|.|:
Human   461 RIHTGEKPYECSECRKTFRHRSGLMQHQRT 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 17/91 (19%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..331 CDD:275368 8/20 (40%)
C2H2 Zn finger 339..360 CDD:275368 6/20 (30%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 7/21 (33%)
C2H2 Zn finger 399..417 CDD:275368 6/17 (35%)
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708 18/116 (16%)
SCAN 44..122 CDD:280241 13/84 (15%)
COG5048 281..>360 CDD:227381 10/82 (12%)
zf-C2H2 301..323 CDD:278523 3/21 (14%)
C2H2 Zn finger 303..323 CDD:275368 3/19 (16%)
zf-H2C2_2 316..339 CDD:290200 4/22 (18%)
COG5048 <328..479 CDD:227381 46/159 (29%)
C2H2 Zn finger 331..351 CDD:275368 2/23 (9%)
zf-H2C2_2 343..366 CDD:290200 6/26 (23%)
C2H2 Zn finger 359..379 CDD:275368 6/19 (32%)
zf-H2C2_2 371..396 CDD:290200 12/25 (48%)
C2H2 Zn finger 387..407 CDD:275368 8/20 (40%)
zf-H2C2_2 399..424 CDD:290200 8/24 (33%)
C2H2 Zn finger 415..435 CDD:275368 6/20 (30%)
zf-H2C2_2 428..452 CDD:290200 8/27 (30%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
zf-H2C2_2 455..480 CDD:290200 8/24 (33%)
C2H2 Zn finger 471..491 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.