DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF101

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_149981.2 Gene:ZNF101 / 94039 HGNCID:12881 Length:436 Species:Homo sapiens


Alignment Length:416 Identity:103/416 - (24%)
Similarity:166/416 - (39%) Gaps:93/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RTCGQEAEHAKSLFDKEARDVLSNI--LKLTGFWLRNQPGVPTRICLSC-LLDLNDAIAFRERCI 67
            |.||::.       ..|.|:..|.|  ..|.   .::|.||....|..| .:.|..  :|.:|.:
Human    69 RLCGRKE-------GNEHRETFSQIPDCHLN---KKSQTGVKPCKCSVCGKVFLRH--SFLDRHM 121

  Fly    68 RTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVE 132
            |.::.  .|:.:......||.|:   .:...:..:.|.|.|   ||.:.|.|.:           
Human   122 RAHAG--HKRSECGGEWRETPRK---QKQHGKASISPSSGA---RRTVTPTRKR----------- 167

  Fly   133 TPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQV 197
                              |..|:...:..:.|.|   :.:....|   ..:.....:|..|...|
Human   168 ------------------PYECKVCGKAFNSPNL---FQIHQRTH---TGKRSYKCREIVRAFTV 208

  Fly   198 I------GEVQKNRRKPRSKGCLEECPGK--DMAKIENIDSTTNKTKEEKYATRNKWGAA----- 249
            .      |::....::...|.|     ||  |...:..|...|: |.|:.|..: :.|.|     
Human   209 SSFFRKHGKMHTGEKRYECKYC-----GKPIDYPSLFQIHVRTH-TGEKPYKCK-QCGKAFISAG 266

  Fly   250 ------KRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVR 308
                  .|::||| :.:.|.:|||..|...:.:.|.|.|.|.|.::||:|.::......|..|.|
Human   267 YLRTHEIRSHALE-KSHQCQECGKKLSCSSSLHRHERTHSGGKLYECQKCAKVFRCPTSLQAHER 330

  Fly   309 IKHRGELPYVCKYCGKRFD--NCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHT 371
             .|.||.||.|..|||.|:  :|.:|  |::.|..   .:|:.|:.|.|||...::|:.|.:.||
Human   331 -AHTGERPYECNKCGKTFNYPSCFRR--HKKTHSG---EKPYECTRCGKAFGWCSSLRRHEMTHT 389

  Fly   372 GEQPFHCELCQTFFNRRNALATHYKS 397
            ||:||.|:.|...|...|.|..|.::
Human   390 GEKPFDCKQCGKVFTFSNYLRLHERT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 17/72 (24%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 33/86 (38%)
C2H2 Zn finger 319..339 CDD:275368 8/21 (38%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 8/23 (35%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZNF101NP_149981.2 KRAB 4..>46 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 104..124 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..164 9/41 (22%)
lambda-1 149..>209 CDD:212564 14/97 (14%)
C2H2 Zn finger 171..191 CDD:275368 3/22 (14%)
COG5048 <176..357 CDD:227381 51/197 (26%)
C2H2 Zn finger 199..219 CDD:275368 4/19 (21%)
C2H2 Zn finger 227..247 CDD:275368 6/24 (25%)
zf-H2C2_2 240..264 CDD:290200 7/25 (28%)
C2H2 Zn finger 255..276 CDD:275368 3/21 (14%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
C2H2 Zn finger 312..332 CDD:275368 6/20 (30%)
zf-H2C2_2 324..349 CDD:290200 13/25 (52%)
COG5048 336..>407 CDD:227381 28/75 (37%)
C2H2 Zn finger 340..360 CDD:275368 8/21 (38%)
zf-H2C2_2 353..375 CDD:290200 7/26 (27%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
zf-H2C2_2 380..404 CDD:290200 10/23 (43%)
C2H2 Zn finger 396..416 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.