DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17806 and ADR1

DIOPT Version :9

Sequence 1:	NP_650658.1	Gene:	CG17806 / 42142	FlyBaseID:	FBgn0038548	Length:	421	Species:	Drosophila melanogaster
Sequence 2:	NP_010502.3	Gene:	ADR1 / 851802	SGDID:	S000002624	Length:	1323	Species:	Saccharomyces cerevisiae

Alignment Length:	72	Identity:	26/72 - (36%)
Similarity:	33/72 - (45%)	Gaps:	0/72 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   346 RPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEEQSKM 410
            |..||..|.:||.....||.|...||.|:|:.|.||...|.||:.|..|.:..|.....|..|..
Yeast   102 RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETISHT 166

  Fly   411 PKMDATV 417
            .|:..|:
Yeast   167 KKVSRTI 173

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17806	NP_650658.1	zf-AD	4..76	CDD:285071
		zf-C2H2	260..282	CDD:278523
		C2H2 Zn finger	262..282	CDD:275368
		C2H2 Zn finger	290..311	CDD:275368
		COG5048	<298..>383	CDD:227381	16/36 (44%)
		C2H2 Zn finger	319..339	CDD:275368
		C2H2 Zn finger	350..370	CDD:275368	7/19 (37%)
		ZnF_U1	375..407	CDD:197732	11/31 (35%)
		C2H2 Zn finger	378..396	CDD:275368	8/17 (47%)
ADR1	NP_010502.3	zf-C2H2	104..126	CDD:395048	8/21 (38%)
		C2H2 Zn finger	106..126	CDD:275368	7/19 (37%)
		zf-H2C2_2	118..143	CDD:404364	11/24 (46%)
		C2H2 Zn finger	134..155	CDD:275368	8/20 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100