DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF566

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001138815.1 Gene:ZNF566 / 84924 HGNCID:25919 Length:419 Species:Homo sapiens


Alignment Length:434 Identity:110/434 - (25%)
Similarity:172/434 - (39%) Gaps:121/434 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVL----SNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQE-DS 83
            |||:    ||::.:.|..: ::|.|               |::.|            |||:. .:
Human    32 RDVMLENYSNLVSMAGHSI-SKPNV---------------ISYLE------------QGKEPWLA 68

  Fly    84 DTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADL 148
            |.|..| |....||||.:.         ::..|.:...:::....:.:|    .|...:...:..
Human    69 DRELTR-GQWPVLESRCET---------KKLFLKKEIYEIESTQWEIME----KLTRRDFQCSSF 119

  Fly   149 VDPLRCEDPIQVKSE--------PQL---SSDYPVESMNHEEPASEMPQVM---------KEEPR 193
            .|...|..  |.|.|        .||   ..|.|  :::| .|:..:.|::         ||..:
Human   120 RDDWECNR--QFKKELGSQGGHFNQLVFTHEDLP--TLSH-HPSFTLQQIINSKKKFCASKEYRK 179

  Fly   194 TLQ-----VIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRA- 252
            |.:     ...|:.....||..  | :|| ||.......:      |..:|..|..|....|.. 
Human   180 TFRHGSQFATHEIIHTIEKPYE--C-KEC-GKSFRHPSRL------THHQKIHTGKKPFECKECG 234

  Fly   253 --------YALEHRL------YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDR-----MEF 298
                    ....||:      |.|.:|||.||...||..|.|.|.|.|.::|:||.:     ..|
Human   235 KTFICGSDLTRHHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYECKECGKAFSSGSNF 299

  Fly   299 TQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTAL 363
            ||     |.|| |.||.||.||.||..|....:.:.|:|.|..   .:|:.|..|:|||::.:.|
Human   300 TQ-----HQRI-HTGEKPYECKECGNAFSQSSQLIKHQRIHTG---EKPYECKECEKAFRSGSDL 355

  Fly   364 KDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEEQ 407
            ..|..:||||:|:.|::|...:::.:.|.:     |||:...|:
Human   356 TRHQRIHTGEKPYECKICGKAYSQSSQLIS-----HHRIHTSEK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 10/55 (18%)
zf-C2H2 260..282 CDD:278523 11/21 (52%)
C2H2 Zn finger 262..282 CDD:275368 10/19 (53%)
C2H2 Zn finger 290..311 CDD:275368 9/25 (36%)
COG5048 <298..>383 CDD:227381 34/84 (40%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 7/31 (23%)
C2H2 Zn finger 378..396 CDD:275368 3/17 (18%)
ZNF566NP_001138815.1 KRAB 6..66 CDD:214630 13/61 (21%)
KRAB 6..45 CDD:279668 5/12 (42%)
COG5048 <154..330 CDD:227381 54/192 (28%)
zf-C2H2 200..222 CDD:278523 7/31 (23%)
C2H2 Zn finger 202..222 CDD:275368 7/27 (26%)
zf-H2C2_2 215..237 CDD:290200 5/27 (19%)
C2H2 Zn finger 230..250 CDD:275368 3/19 (16%)
zf-H2C2_2 242..267 CDD:290200 8/24 (33%)
COG5048 <254..405 CDD:227381 56/155 (36%)
C2H2 Zn finger 258..278 CDD:275368 10/19 (53%)
zf-H2C2_2 270..295 CDD:290200 10/24 (42%)
C2H2 Zn finger 286..306 CDD:275368 9/25 (36%)
zf-H2C2_2 298..323 CDD:290200 16/30 (53%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..351 CDD:290200 9/26 (35%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 9/24 (38%)
C2H2 Zn finger 370..390 CDD:275368 6/24 (25%)
C2H2 Zn finger 398..417 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.