DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and TT1

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:301 Identity:68/301 - (22%)
Similarity:103/301 - (34%) Gaps:102/301 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LVDPLRCEDPIQVKSEPQLSSD--YPVESMNHEEPASEMPQVMKEEPRTLQV--------IGEVQ 202
            |::||...|.|.:.|...|:.:  |..|....||..       :||.|.:.|        .|:..
plant    41 LIEPLPLIDRINLNSNLDLNPNPLYAEEGEQEEEEE-------EEEDREVDVDLHIGLPGFGKPS 98

  Fly   203 KNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGK 267
            .:.::      |::..||::|..:     ..|..|.:.:.:..|..|.....:....:.|..|.|
plant    99 NDAKQ------LKKRNGKEIATYD-----AGKGIENELSGKAYWIPAPEQILIGFTHFSCHVCFK 152

  Fly   268 TFSEKGNFNVHLRRH-----------KGTKE--------FQCQECDRMEFTQHL----------- 302
            ||:...|..:|:..|           |||:.        :.|.|..|    .|:           
plant   153 TFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCVEGCR----NHIDHPRSKPLKDF 213

  Fly   303 --LNLHVRIKHRGELPYVCKYCGKRF----------DNCLKRLNHERNHKESPVHRPHVCSTCQK 355
              |..|.:.|| |..|:.|:.|||..          .||.||               .|| .|..
plant   214 RTLQTHYKRKH-GHKPFSCRLCGKLLAVKGDWRTHEKNCGKR---------------WVC-VCGS 261

  Fly   356 AFKTSTALKDHIVVH--------TG---EQPFHCELCQTFF 385
            .||...:||||:...        ||   ||..:..:.:|.|
plant   262 DFKHKRSLKDHVKAFGSGHGPYPTGLFEEQASNSSVSETLF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/33 (18%)
COG5048 <298..>383 CDD:227381 28/118 (24%)
C2H2 Zn finger 319..339 CDD:275368 8/29 (28%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 2/11 (18%)
C2H2 Zn finger 378..396 CDD:275368 2/8 (25%)
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
C2H2 Zn finger 257..274 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.