DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and WIP3

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:251 Identity:59/251 - (23%)
Similarity:87/251 - (34%) Gaps:81/251 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 MNHEEPASEMPQVMKEEPRTLQVIGEVQKNR--------------RKPRSKGCLEECPGKDMAK- 224
            |.:...||::.:..|::..||| ||..:.:|              :||..:..:|:  |..|.| 
plant    82 MENNSQASDIKEENKDDVVTLQ-IGFPKYHRGSSEDGSDITFDHQKKPIKREIIED--GVVMMKK 143

  Fly   225 -------IENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRH 282
                   .|.|||      :.:...:..|..:.....:....:.|..|.|||:...|..:|:..|
plant   144 RRKMKFDEEIIDS------DVEVCGKRFWIPSPAQIHVGPMQFACSICSKTFNRYNNMQMHMWGH 202

  Fly   283 -----------KGTKE---------FQCQE-CDR----------MEFTQHLLNLHVRIKHRGELP 316
                       |||.:         :.|.| |..          .:|  ..|..|.:.|| |..|
plant   203 GSEFRKGADSLKGTIQPAAILRLPCYCCAEGCKNNINHPRSKPLKDF--RTLQTHYKRKH-GSKP 264

  Fly   317 YVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCS-----TCQKAFKTSTALKDHI 367
            :.|..|||..........||:|           |.     ||...||...:|||||
plant   265 FSCGKCGKALAVKGDWRTHEKN-----------CGKLWYCTCGSDFKHKRSLKDHI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/31 (19%)
COG5048 <298..>383 CDD:227381 24/75 (32%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 10/23 (43%)
ZnF_U1 375..407 CDD:197732
C2H2 Zn finger 378..396 CDD:275368
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.