DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZKSCAN3

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001229823.1 Gene:ZKSCAN3 / 80317 HGNCID:13853 Length:538 Species:Homo sapiens


Alignment Length:420 Identity:103/420 - (24%)
Similarity:170/420 - (40%) Gaps:81/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
            |:.||.:.:|...||  ||.:.::..:..||.|...:......::   ||..:|..:...:....
Human    61 REALSRLRELCRQWL--QPEMHSKEQILELLVLEQFLTILPGNLQ---SWVREQHPESGEEVVVL 120

  Fly    89 REGGNNRLE------SRVD------------VMPISIAQPQRRRILPQ--RSKKVDGVPL--KTV 131
            .|....:|:      |.||            :.|...:|..:.:::..  :.:.|...||  :.:
Human   121 LEYLERQLDEPAPQVSGVDQGQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVL 185

  Fly   132 ETPIY---------PLVVPEIPP--------ADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEE 179
            :.|:.         .:|...:.|        .|:...|..|...|..|:..|..|...|  ||..
Human   186 QVPVLAHGGCCREDKVVASRLTPESQGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQE--NHGS 248

  Fly   180 PASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIE--------NIDSTTNKTK 236
            ..|     :.:|.:|        |:|..|.:    ||.|.|:..||.        .|.:.....:
Human   249 LVS-----LGDEKQT--------KSRDLPPA----EELPEKEHGKISCHLREDIAQIPTCAEAGE 296

  Fly   237 EEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQH 301
            :|....|      |:..|...|.:.|.:|||:|::....:.|.|.|.|.|.::|:||.:......
Human   297 QEGRLQR------KQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSS 355

  Fly   302 LLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDH 366
            .|.:|.|: |.||.||.|:.|||.|.:....:.|:|.|..   .:|:.|..|.|.|..|.:|.:|
Human   356 ALVIHQRV-HTGEKPYECEECGKAFSHSSDLIKHQRTHTG---EKPYECDDCGKTFSQSCSLLEH 416

  Fly   367 IVVHTGEQPFHCELCQTFFNRRNALATHYK 396
            ..:||||:|:.|.:|...|.|.:.|..|.:
Human   417 HRIHTGEKPYQCSMCGKAFRRSSHLLRHQR 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 13/51 (25%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 31/84 (37%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 7/22 (32%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZKSCAN3NP_001229823.1 SCAN 42..154 CDD:128708 19/97 (20%)
SCAN 42..130 CDD:280241 16/73 (22%)
KRAB 214..274 CDD:214630 20/78 (26%)
KRAB 217..252 CDD:279668 11/41 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..274 18/66 (27%)
zf-C2H2 314..336 CDD:278523 7/21 (33%)
C2H2 Zn finger 316..336 CDD:275368 7/19 (37%)
zf-H2C2_2 329..351 CDD:290200 8/21 (38%)
C2H2 Zn finger 344..364 CDD:275368 6/20 (30%)
zf-H2C2_2 356..381 CDD:290200 13/25 (52%)
COG5048 <368..515 CDD:227381 29/82 (35%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 384..409 CDD:290200 8/27 (30%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
zf-H2C2_2 412..437 CDD:290200 10/24 (42%)
C2H2 Zn finger 428..448 CDD:275368 6/19 (32%)
zf-C2H2 480..502 CDD:278523
C2H2 Zn finger 482..502 CDD:275368
zf-H2C2_2 495..519 CDD:290200
C2H2 Zn finger 510..530 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.