DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF557

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001037852.1 Gene:ZNF557 / 79230 HGNCID:28632 Length:430 Species:Homo sapiens


Alignment Length:386 Identity:102/386 - (26%)
Similarity:154/386 - (39%) Gaps:80/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLND-AIAFRERCIRTNSSWFEKQGKQEDSDT 85
            |..::::.:||   .||:.            |:...| |:.|      |...|......|.....
Human    26 EGGELVNELLK---SWLKG------------LVTFEDVAVEF------TQEEWALLDPAQRTLYR 69

  Fly    86 ETAREGGNN--RLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADL 148
            :...|...|  .|.::|| .|..|:|      |.|..|      :.|.|..|.....|::     
Human    70 DVMLENCRNLASLGNQVD-KPRLISQ------LEQEDK------VMTEERGILSGTCPDV----- 116

  Fly   149 VDPLRCEDPIQVKS-EPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVI---GEVQKNRR--- 206
                  |:|.:.|. .|:|......:|.|.:...:.:...:.|..:..:|.   ..:.::|:   
Human   117 ------ENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGATLNECNQCFKVFSTKSSLTRHRKIHT 175

  Fly   207 KPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSE 271
            ..|..|| .|| ||                  .|::|:.....||.:..| :.|.|:.||||||.
Human   176 GERPYGC-SEC-GK------------------SYSSRSYLAVHKRIHNGE-KPYECNDCGKTFSS 219

  Fly   272 KGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHE 336
            :....||.|.|.|.|.::|.:|.:.......|..|:|| |.||.||.|..|.:.|........|:
Human   220 RSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRPHLRI-HTGEKPYKCNQCFREFRTQSIFTRHK 283

  Fly   337 RNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKS 397
            |.| ....|  :||:.|.|||.|.::|..|..:||||.|:.|..|...|.||:.|..|.::
Human   284 RVH-TGEGH--YVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 11/54 (20%)
zf-C2H2 260..282 CDD:278523 11/21 (52%)
C2H2 Zn finger 262..282 CDD:275368 10/19 (53%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 32/84 (38%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 8/23 (35%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
ZNF557NP_001037852.1 KRAB 43..100 CDD:214630 16/69 (23%)
KRAB 43..82 CDD:279668 8/44 (18%)
COG5048 <137..422 CDD:227381 70/230 (30%)
C2H2 Zn finger 154..174 CDD:275368 2/19 (11%)
C2H2 Zn finger 182..202 CDD:275368 9/39 (23%)
zf-H2C2_2 194..219 CDD:290200 10/25 (40%)
C2H2 Zn finger 210..230 CDD:275368 10/19 (53%)
zf-H2C2_2 222..247 CDD:290200 8/24 (33%)
C2H2 Zn finger 238..258 CDD:275368 6/20 (30%)
zf-H2C2_2 254..275 CDD:290200 11/21 (52%)
C2H2 Zn finger 266..286 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
zf-C2H2 320..342 CDD:278523 7/22 (32%)
C2H2 Zn finger 322..342 CDD:275368 7/20 (35%)
zf-H2C2_2 334..359 CDD:290200 2/8 (25%)
C2H2 Zn finger 350..370 CDD:275368
zf-H2C2_2 362..386 CDD:290200
C2H2 Zn finger 378..398 CDD:275368
zf-H2C2_2 390..415 CDD:290200
C2H2 Zn finger 406..426 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.