DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF232

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_055334.2 Gene:ZNF232 / 7775 HGNCID:13026 Length:444 Species:Homo sapiens


Alignment Length:437 Identity:105/437 - (24%)
Similarity:158/437 - (36%) Gaps:128/437 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NSSWFE------------------------KQG---------KQEDSDTE-TAREGGNNRLESRV 100
            :|||:|                        .||         |:|:...| ..|..||:.....:
Human    13 DSSWYEPSAELVQTRMAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEI 77

  Fly   101 DVMPISIAQPQRRRILPQRSKKVDGV----------------PLKTVETPIYPLVVPE----IPP 145
                      .|:|....|.::..|.                |.|..:..|...:|.|    |.|
Human    78 ----------FRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILEFLVLEQFLTILP 132

  Fly   146 ADLVD------PLRCEDPIQV--------KSEPQLSSDYPVESMNHEEP---------ASE---- 183
            .:|..      |...|:.:.|        :.|||:..  |......|||         |.|    
Human   133 EELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQVPG--PAHGPAQEEPWEKKESLGAAQEALSI 195

  Fly   184 --MPQVMKEEPRTLQV----IGEVQKNRRKPRSKGCLEECPGKDM------AKIENIDSTTNKTK 236
              .|:..:..|::.||    :..|.::..:|:.||.|.:.|..::      .|:....||...|.
Human   196 QLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATS 260

  Fly   237 E--------EKYATRNKWGAAK----RAYALEHRL-------YFCDQCGKTFSEKGNFNVHLRRH 282
            |        ...|.|.:|..|:    |...:.|:.       :.|.:|||||....:..||.|.|
Human   261 EGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSECGKTFIYNSHLVVHQRVH 325

  Fly   283 KGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRP 347
            .|.|.::|.:|.:.......|..|.|| |.||.|:.|..|||.|......:.|:|.|..   .:|
Human   326 SGEKPYKCSDCGKTFKQSSNLGQHQRI-HTGEKPFECNECGKAFRWGAHLVQHQRIHSG---EKP 386

  Fly   348 HVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATH 394
            :.|:.|.|||..|:.|..|..:|:||:||.|:.|...:...:.|..|
Human   387 YECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 4/29 (14%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 32/84 (38%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 6/20 (30%)
C2H2 Zn finger 378..396 CDD:275368 4/17 (24%)
ZNF232NP_055334.2 SCAN 75..188 CDD:128708 22/124 (18%)
SCAN 75..162 CDD:280241 15/96 (16%)
COG5048 <303..409 CDD:227381 39/109 (36%)
zf-C2H2 303..325 CDD:278523 9/21 (43%)
C2H2 Zn finger 305..325 CDD:275368 9/19 (47%)
zf-H2C2_2 317..342 CDD:290200 8/24 (33%)
C2H2 Zn finger 333..353 CDD:275368 6/20 (30%)
zf-H2C2_2 345..368 CDD:290200 12/23 (52%)
C2H2 Zn finger 361..381 CDD:275368 7/19 (37%)
zf-H2C2_2 373..398 CDD:290200 9/27 (33%)
COG5048 385..>437 CDD:227381 18/49 (37%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)
zf-H2C2_2 401..424 CDD:290200 9/22 (41%)
C2H2 Zn finger 417..437 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.