Sequence 1: | NP_650658.1 | Gene: | CG17806 / 42142 | FlyBaseID: | FBgn0038548 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001288708.1 | Gene: | ZNF202 / 7753 | HGNCID: | 12994 | Length: | 648 | Species: | Homo sapiens |
Alignment Length: | 509 | Identity: | 112/509 - (22%) |
---|---|---|---|
Similarity: | 169/509 - (33%) | Gaps: | 176/509 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
Fly 89 REGGNNRLESRVDVMPISIAQPQRRRILPQR--SKKVDGVPLKTVETPIYPLVVPEIPPADLVDP 151
Fly 152 LRCEDPIQVKSEPQLSSDY--PVESMNHEE-------------------PA-------------- 181
Fly 182 ------------------------------------------------------SEMPQVMKEEP 192
Fly 193 RTLQVIGEVQKNRRK---------PRSKGCLEECPGKDMAKIENI-------------------- 228
Fly 229 DSTTNKTKEEKYATR----NKWGAAKR---AYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTK 286
Fly 287 EFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESP-------- 343
Fly 344 -VHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYK 396 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17806 | NP_650658.1 | zf-AD | 4..76 | CDD:285071 | 13/51 (25%) |
zf-C2H2 | 260..282 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 290..311 | CDD:275368 | 5/20 (25%) | ||
COG5048 | <298..>383 | CDD:227381 | 27/93 (29%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 6/19 (32%) | ||
ZnF_U1 | 375..407 | CDD:197732 | 8/22 (36%) | ||
C2H2 Zn finger | 378..396 | CDD:275368 | 6/17 (35%) | ||
ZNF202 | NP_001288708.1 | SCAN | 43..153 | CDD:128708 | 27/115 (23%) |
SCAN | 43..130 | CDD:280241 | 19/89 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..221 | 20/76 (26%) | |||
KRAB | 237..297 | CDD:214630 | 6/60 (10%) | ||
KRAB | 237..277 | CDD:279668 | 0/39 (0%) | ||
COG5048 | 397..>644 | CDD:227381 | 45/146 (31%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 411..436 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 427..447 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 483..503 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 495..520 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 511..531 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 539..559 | CDD:275368 | |||
C2H2 Zn finger | 567..587 | CDD:275368 | |||
zf-C2H2 | 593..615 | CDD:278523 | |||
C2H2 Zn finger | 595..615 | CDD:275368 | |||
zf-H2C2_2 | 607..632 | CDD:290200 | |||
C2H2 Zn finger | 623..643 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |