DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZSCAN21

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001349708.1 Gene:ZSCAN21 / 7589 HGNCID:13104 Length:473 Species:Homo sapiens


Alignment Length:433 Identity:109/433 - (25%)
Similarity:161/433 - (37%) Gaps:99/433 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
            |:.||.:..|...|||  |.:.|:..:..||.|...:....:.::   :|.::...:...:..|.
Human    60 REALSQLRVLCCEWLR--PEIHTKEQILELLVLEQFLTILPQELQ---AWVQEHCPESAEEAVTL 119

  Fly    89 REGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLV-----VPEIPPADL 148
            .|.    ||..:|       :|..:...|...:|           |::..:     ..|.|.:..
Human   120 LED----LERELD-------EPGHQVSTPPNEQK-----------PVWEKISSSGTAKESPSSMQ 162

  Fly   149 VDPLRCEDP--------IQVKSEPQLSSDYPVE------SMNHEEPASEMPQVMKEEPRTLQVIG 199
            ..||.....        ||...|.|..:..|.:      |..|||.|.|. :..:.|.....:|.
Human   163 PQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQ-KGSEAEGLKGDIIS 226

  Fly   200 EVQKNRRKPRSKGCLEECPGKDMAKIEN-------IDSTTNKTKEEKYATRNKWGAAKRAYALEH 257
            .:..|  ||.:.  ||    :....:||       :....:|...|...|:...|         .
Human   227 VIIAN--KPEAS--LE----RQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPG---------E 274

  Fly   258 RLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYC 322
            |.|.|.:|||.||...|...|.|.|.|.|.:.|.:|.:.......|.||.| .|..:.||.|| |
Human   275 RRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYR-THLVDRPYDCK-C 337

  Fly   323 GKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNR 387
            ||.|......|.|:|.|.|   ..|:.|..|.|||....:|..|..:||||:|:.|..|...|::
Human   338 GKAFGQSSDLLKHQRMHTE---EAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQ 399

  Fly   388 RNALATH---------YK--------------SKHHRLKVEEQ 407
            ...|::|         ||              :||||:...|:
Human   400 HAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 13/51 (25%)
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 33/84 (39%)
C2H2 Zn finger 319..339 CDD:275368 9/19 (47%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 12/54 (22%)
C2H2 Zn finger 378..396 CDD:275368 5/26 (19%)
ZSCAN21NP_001349708.1 SCAN 42..153 CDD:128708 22/119 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..169 9/59 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..272 5/27 (19%)
COG5048 <276..453 CDD:227381 58/172 (34%)
C2H2 Zn finger 279..299 CDD:275368 9/19 (47%)
C2H2 Zn finger 307..327 CDD:275368 6/20 (30%)
C2H2 Zn finger 337..354 CDD:275368 7/16 (44%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 418..438 CDD:275368 4/19 (21%)
C2H2 Zn finger 446..466 CDD:275368
zf-C2H2 446..466 CDD:395048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.