DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF24

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001362744.1 Gene:ZNF24 / 7572 HGNCID:13032 Length:368 Species:Homo sapiens


Alignment Length:397 Identity:90/397 - (22%)
Similarity:150/397 - (37%) Gaps:117/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
            |:.:|.:.:|...|||  |...|:..:..|:.|...:|...:.::|   |......:...:..|.
Human    67 REAVSQLRELCRLWLR--PETHTKEQILELVVLEQFVAILPKELQT---WVRDHHPENGEEAVTV 126

  Fly    89 REGGNNRLESRVD--VMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPADLVDP 151
            .|.    |||.:|  ..|:|:.: ::|.:|              ||..:.......:|.::|   
Human   127 LED----LESELDDPGQPVSLRR-RKREVL--------------VEDMVSQEEAQGLPSSEL--- 169

  Fly   152 LRCEDPIQVKSEPQLS-SDYPVESMNHEE-----------PASEMPQVMK--EEPRTLQVIGEVQ 202
                |.:    |.||. :.:.:.|:.|.:           |..|:|..::  |.|.||       
Human   170 ----DAV----ENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTL------- 219

  Fly   203 KNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGK 267
             |...|:.....|.|..|            .:.:.::..:|.|          :|   .||:|||
Human   220 -NMGVPQIFKYGETCFPK------------GRFERKRNPSRKK----------QH---ICDECGK 258

  Fly   268 TFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKR 332
            .||:.....:|.|.|.|.|.:.|.||.:......:|..|.|: |.||.||.|..|||.|......
Human   259 HFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV-HTGEKPYKCLECGKAFSQNSGL 322

  Fly   333 LNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKS 397
            :||:|                               :||||:|:.|..|...:::.:.|..|.: 
Human   323 INHQR-------------------------------IHTGEKPYECVQCGKSYSQSSNLFRHQR- 355

  Fly   398 KHHRLKV 404
            :|:..|:
Human   356 RHNAEKL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 13/51 (25%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 23/84 (27%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 0/19 (0%)
ZnF_U1 375..407 CDD:197732 7/30 (23%)
C2H2 Zn finger 378..396 CDD:275368 4/17 (24%)
ZNF24NP_001362744.1 SCAN 48..160 CDD:128708 25/116 (22%)
COG5048 <249..329 CDD:227381 33/124 (27%)
Necessary and sufficient for nuclear localization 251..301 19/53 (36%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
COG5048 305..>358 CDD:227381 19/84 (23%)
C2H2 Zn finger 309..329 CDD:275368 8/50 (16%)
C2H2 Zn finger 337..357 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.