DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and GZF1

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001303941.1 Gene:GZF1 / 64412 HGNCID:15808 Length:711 Species:Homo sapiens


Alignment Length:465 Identity:115/465 - (24%)
Similarity:158/465 - (33%) Gaps:159/465 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPI--------- 105
            |.| |||::. .|:.:.....|...|.|...|..:.|.:.       .|:|...|.         
Human   116 LKC-LDLSET-CFQLKKQMLESVLLELQNFSESQEVEVSS-------GSQVSAAPAPRASVATDG 171

  Fly   106 --------SIAQPQRRR-------ILPQRSK-KVDGVPLKTVETPIYP------------LVVPE 142
                    |:..|..|.       :.|::|| |:|  ..|.|..|.||            .|..|
Human   172 PHPSGLTDSLDYPGERASNGMSSDLPPKKSKDKLD--KKKEVVKPPYPKIRRASGRLAGRKVFVE 234

  Fly   143 IPPADLVDPLRCEDPIQVKSEPQLSSDYPV-ESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNRR 206
            ||.......||    .|.|:......||.. :..:.:...:||.||.|.|               
Human   235 IPKKKYTRRLR----EQQKTAEGDVGDYRCPQDQSPDRVGTEMEQVSKNE--------------- 280

  Fly   207 KPRSKGC-----LEECPGKDMAKIENIDSTTNKTKE-EKYATRNKWGAAKRAYALE--------H 257
                 ||     |||...|  |..|..:....:.:| ||..:..|....::|:..|        |
Human   281 -----GCQAGAELEELSKK--AGPEEEEEEEEEDEEGEKKKSNFKCSICEKAFLYEKSFLKHSKH 338

  Fly   258 R-------LYFCDQCGKTFSEKGN----------------------------------------- 274
            |       :|.||.||:||:.:.|                                         
Human   339 RHGVATEVVYRCDTCGQTFANRCNLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVLQVHEGG 403

  Fly   275 ------------------FNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKY 321
                              ..:|.|.|.|.:.:.|.||.........|..|:|| |.||.|:||..
Human   404 GERHRCGQCGKGLSSKTALRLHERTHTGDRPYGCTECGARFSQPSALKTHMRI-HTGEKPFVCDE 467

  Fly   322 CGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFN 386
            ||.||......:.|:|.|..   .||.:|.||.|:|.:...||.|..:|||.:||.||:|...|.
Human   468 CGARFTQNHMLIYHKRCHTG---ERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFA 529

  Fly   387 RRNALATHYK 396
            :||:|..|.|
Human   530 QRNSLYQHIK 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 7/25 (28%)
zf-C2H2 260..282 CDD:278523 10/80 (13%)
C2H2 Zn finger 262..282 CDD:275368 9/78 (12%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 35/84 (42%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 11/22 (50%)
C2H2 Zn finger 378..396 CDD:275368 8/17 (47%)
GZF1NP_001303941.1 BTB 21..133 CDD:306997 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..220 16/75 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..312 21/94 (22%)
C2H2 Zn finger 319..339 CDD:275368 2/19 (11%)
C2H2 Zn finger 350..371 CDD:275368 7/20 (35%)
COG5048 <405..593 CDD:227381 48/139 (35%)
C2H2 Zn finger 409..429 CDD:275368 2/19 (11%)
C2H2 Zn finger 437..457 CDD:275368 7/20 (35%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
C2H2 Zn finger 493..513 CDD:275368 8/19 (42%)
C2H2 Zn finger 521..541 CDD:275368 9/19 (47%)
C2H2 Zn finger 549..569 CDD:275368
C2H2 Zn finger 577..597 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.