DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZSCAN31

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001128687.1 Gene:ZSCAN31 / 64288 HGNCID:14097 Length:406 Species:Homo sapiens


Alignment Length:415 Identity:112/415 - (26%)
Similarity:180/415 - (43%) Gaps:76/415 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQEAEHAKSLFDK-------EARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERC 66
            ||||  ::.||.:       ..|:.||.:.:|...|||  |.:.|:..:..||.|...:......
Human    34 GQEA--SRQLFRQFCYQETPGPREALSRLRELCHQWLR--PEIHTKEQILELLVLEQFLTILPEE 94

  Fly    67 IRTNSSWFE----KQGKQ-----EDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKK 122
            ::   :|..    :.|::     ||.:.|.: |.||...:.......:.:             :.
Human    95 LQ---AWVREHHPESGEEAVAVVEDLEQELS-EPGNQAPDHEHGHSEVLL-------------ED 142

  Fly   123 VDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQV 187
            |:.:.:|...|.|      ::.|  :|..||.|.....:.:.|.....|    .::|.||:. ::
Human   143 VEHLKVKQEPTDI------QLQP--MVTQLRYESFCLHQFQEQDGESIP----ENQELASKQ-EI 194

  Fly   188 MKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAA--K 250
            :||    ::.:|:.:..|.........|.|.....|:.:...||     .|:....|:.|.:  |
Human   195 LKE----MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHST-----GERRHRCNECGKSFTK 250

  Fly   251 RAYALEH-------RLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVR 308
            .:..:||       :.|.|::|||.||.:.:.|.|.|.|.|.|.:||:||.:.....:.|..|.|
Human   251 SSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRR 315

  Fly   309 IKHRGELPYVCKYCGKRF--DNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHT 371
            | |.||.||.||.|||.|  .:||  :.|:|.|..   .:.:.|..|.|||..:..|..|:.|||
Human   316 I-HTGEKPYECKVCGKAFLLSSCL--VQHQRIHTG---EKRYQCRECGKAFIQNAGLFQHLRVHT 374

  Fly   372 GEQPFHCELCQTFFNRRNALATHYK 396
            ||:|:.|..|...|::|..|..|.|
Human   375 GEKPYQCSQCSKLFSKRTLLKKHQK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 19/77 (25%)
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 35/86 (41%)
C2H2 Zn finger 319..339 CDD:275368 10/21 (48%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 8/22 (36%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
ZSCAN31NP_001128687.1 SCAN 35..146 CDD:128708 26/131 (20%)
SCAN 35..123 CDD:280241 22/95 (23%)
COG5048 <156..397 CDD:227381 80/262 (31%)
zf-C2H2 239..261 CDD:278523 5/21 (24%)
C2H2 Zn finger 241..261 CDD:275368 5/19 (26%)
zf-H2C2_2 254..278 CDD:290200 8/23 (35%)
C2H2 Zn finger 269..289 CDD:275368 9/19 (47%)
zf-H2C2_2 281..305 CDD:290200 10/23 (43%)
C2H2 Zn finger 297..317 CDD:275368 7/20 (35%)
zf-H2C2_2 310..332 CDD:290200 14/22 (64%)
C2H2 Zn finger 325..345 CDD:275368 10/21 (48%)
zf-H2C2_2 338..362 CDD:290200 9/28 (32%)
C2H2 Zn finger 353..373 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.