DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF350

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_016882583.1 Gene:ZNF350 / 59348 HGNCID:16656 Length:574 Species:Homo sapiens


Alignment Length:274 Identity:79/274 - (28%)
Similarity:110/274 - (40%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NHE--EPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEE 238
            |||  ..|.:.|...|......|.|....:..||........||....:.|....|.....|.|:
Human   210 NHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEK 274

  Fly   239 KYATRNKWGAAKRAYAL-EH-------RLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDR 295
            .:.......|..|.:.| ||       :.|.|.:|||.|.:|...|:|.:.|.|.|.:.|.||.:
Human   275 PHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGK 339

  Fly   296 MEFTQHLLNLHVRIKHRGELPYVCKYCGKRF--DNCLKRLNHERNHKESPVHRPHVCSTCQKAFK 358
            ....:..|.:|.|| |.||.||:|..|||.|  ..||  :.|:|.|...   .|.|||.|.|:..
Human   340 GFIQKGNLIVHQRI-HTGEKPYICNECGKGFIQKTCL--IAHQRFHTGK---TPFVCSECGKSCS 398

  Fly   359 TSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKS-----------------------KHH 400
            ..:.|..|..:||||:||.|..|...|:.:..|..|.::                       ||.
Human   399 QKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHK 463

  Fly   401 RLKVEEQSKMPKMD 414
            |:...|:.:..|::
Human   464 RIHTREKQEAAKVE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 35/86 (41%)
C2H2 Zn finger 319..339 CDD:275368 9/21 (43%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 10/54 (19%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
ZNF350XP_016882583.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.