Sequence 1: | NP_650658.1 | Gene: | CG17806 / 42142 | FlyBaseID: | FBgn0038548 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092739.1 | Gene: | ZNF506 / 440515 | HGNCID: | 23780 | Length: | 444 | Species: | Homo sapiens |
Alignment Length: | 292 | Identity: | 83/292 - (28%) |
---|---|---|---|
Similarity: | 127/292 - (43%) | Gaps: | 66/292 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 RC-EDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQK--------NRRKP 208
Fly 209 RSKG-----CLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKT 268
Fly 269 FSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRL 333
Fly 334 NHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATH---- 394
Fly 395 -----YK--------------SKHHRLKVEEQ 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17806 | NP_650658.1 | zf-AD | 4..76 | CDD:285071 | |
zf-C2H2 | 260..282 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 290..311 | CDD:275368 | 6/20 (30%) | ||
COG5048 | <298..>383 | CDD:227381 | 32/84 (38%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 8/19 (42%) | ||
ZnF_U1 | 375..407 | CDD:197732 | 15/54 (28%) | ||
C2H2 Zn finger | 378..396 | CDD:275368 | 8/26 (31%) | ||
ZNF506 | NP_001092739.1 | KRAB | 4..62 | CDD:214630 | |
KRAB | 6..43 | CDD:279668 | |||
C2H2 Zn finger | 147..167 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 175..195 | CDD:275368 | 9/39 (23%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 215..240 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 231..251 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 243..268 | CDD:290200 | 13/25 (52%) | ||
COG5048 | <255..417 | CDD:227381 | 38/116 (33%) | ||
C2H2 Zn finger | 259..279 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 272..296 | CDD:290200 | 8/26 (31%) | ||
C2H2 Zn finger | 287..307 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 300..324 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 327..351 | CDD:290200 | 4/23 (17%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 355..379 | CDD:290200 | 5/13 (38%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | |||
zf-H2C2_2 | 384..407 | CDD:290200 | |||
C2H2 Zn finger | 399..419 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |