DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG12071

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster


Alignment Length:361 Identity:75/361 - (20%)
Similarity:126/361 - (34%) Gaps:93/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPL 138
            |::|...:..::.||....|::....:........|.|:::...|:.:.....           :
  Fly    30 FKQQQTSQQQNSPTANNNNNSQNNGNMQQQQQQQQQQQQQQQQQQQQQHYAAT-----------I 83

  Fly   139 VVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIG---- 199
            .||:|..:::......|....|          |.:.|..|...           |.||.:|    
  Fly    84 KVPQISSSNVAAAAAGESTFTV----------PDDGMGFEGGV-----------RVLQSLGTWSA 127

  Fly   200 --EVQKNRRKPR---------SKGCLEECPG-KDMAKIENIDSTTNKTKEEKYATRNKWGAAKRA 252
              ::..|..||.         ..|.:..... |.:.:::...|...||...|  :.||       
  Fly   128 AEQLTYNIPKPNLIPFTEPYVEGGSMHPASRLKALQQVQQASSGVRKTNPSK--STNK------- 183

  Fly   253 YALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHV-RIKHRGELP 316
             |.|     |..|||..:.|....:|:|.|.|.|.:.|:.|::....:..|.:|: :.||  ..|
  Fly   184 -AFE-----CTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIHMNKFKH--VTP 240

  Fly   317 YVCKYCGKRFDNCLKRLNHERNHKESPVHRP----------------HVCS---TCQKAFKTSTA 362
            ......|||.:|.:|:       ||.|...|                .|.:   ..|.|....|:
  Fly   241 TNIAPLGKRLNNMVKK-------KEQPDPPPEDNKQSLELQLQQQAVQVAAQNIIVQSAQGAPTS 298

  Fly   363 LKDHIVVHTGEQ-PFHCELCQTFFNRRNALATHYKS 397
            :...|:.|..:| .:.||||...|:.|:..:.|.||
  Fly   299 IPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAKS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 1/1 (100%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 4/21 (19%)
COG5048 <298..>383 CDD:227381 25/105 (24%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 4/22 (18%)
ZnF_U1 375..407 CDD:197732 9/23 (39%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 8/26 (31%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
zf-H2C2_2 200..224 CDD:290200 7/23 (30%)
C2H2 Zn finger 215..232 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.