DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG4854

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:399 Identity:100/399 - (25%)
Similarity:145/399 - (36%) Gaps:94/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGQEAEHAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRT 69
            ||.|..:.:. :||...|. |....|.:.||..|...|..|.|||.||.|.|..|:..|..|.:|
  Fly    12 CRICLVQPKD-ESLMPTEP-DFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLRSLCQQT 74

  Fly    70 NSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETP 134
                 ||..|                 |.::..:.|.|...:      |.:||         :|.
  Fly    75 -----EKDLK-----------------EQKLQEINIEIVHDE------QETKK---------KTE 102

  Fly   135 IYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIG 199
            ...|...|...:|            .:.|.:....|.|...:.|:.|....:::..||.......
  Fly   103 SRDLSKNEATGSD------------SELEYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEE 155

  Fly   200 EVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQ 264
            .|.....||              ...|:.||                |.|..        :.|:.
  Fly   156 SVYSLSPKP--------------VTFEDEDS----------------GQAAS--------FTCNI 182

  Fly   265 CGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNC 329
            |...:||:.....|::.|...|..:|:.|.:.......|..|:. .|.|..||.|.||..||.:.
  Fly   183 CNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMN-THTGNRPYKCDYCDSRFADP 246

  Fly   330 LKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATH 394
            ..|:.|:|.|..   .||:.|..|.::|..|..|:.|:..||||:||.|:.||..|::.:...:|
  Fly   247 STRIKHQRIHTN---ERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSH 308

  Fly   395 YKSKHHRLK 403
            .|| |.|.|
  Fly   309 EKS-HKRTK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 24/70 (34%)
zf-C2H2 260..282 CDD:278523 5/21 (24%)
C2H2 Zn finger 262..282 CDD:275368 5/19 (26%)
C2H2 Zn finger 290..311 CDD:275368 4/20 (20%)
COG5048 <298..>383 CDD:227381 31/84 (37%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 12/29 (41%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 16/46 (35%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 5/23 (22%)
COG5048 201..>258 CDD:227381 18/57 (32%)
C2H2 Zn finger 208..228 CDD:275368 4/20 (20%)
zf-H2C2_2 221..244 CDD:290200 10/23 (43%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 251..273 CDD:290200 8/24 (33%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 12/23 (52%)
C2H2 Zn finger 292..312 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.