DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG7691

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:273 Identity:61/273 - (22%)
Similarity:92/273 - (33%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VVPEIPPADLVDP-LRCEDPIQVKSEPQLSSDYPVESMNHEEPA------SEMPQVMK---EEPR 193
            |:|.:||  :..| ......:..|.||:.:..: .......||:      .::|.|::   ||..
  Fly    30 VIPNLPP--MPRPKTNHHSRVATKPEPKTNVKF-TYCFGQSEPSGDWRQGDDIPIVVRREMEERL 91

  Fly   194 TLQVIGEVQKNRRKPRSKGCLE-ECPGKDMAKIENIDSTTNKTK-------EEKYATRNKWGAAK 250
            .:|::..:........|....| :.||:   ..::|..|.|..|       .|...||.|     
  Fly    92 GIQLMSVLPITESSLLSHTIWELKMPGE---SFDSIPKTRNGIKVGIITVTAESKQTRTK----- 148

  Fly   251 RAYALEHRLYFCDQCGKTFSEKG----NFNV-------------------HLRRHKGTKEFQCQE 292
                              ...||    |..|                   .|:|..|  :|:|.:
  Fly   149 ------------------LKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGG--QFECID 193

  Fly   293 CDRMEFTQHLLNLHVRIKHRGELPYVCK--YCGKRFDNCLKRLNHER--NHKESPVHRPHVCSTC 353
            ||:......:|..|.| .|.||.|:||.  .|.|.|.:.....:|:|  .|.|    ..|.|..|
  Fly   194 CDKKFDHSWMLTAHTR-THTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHE----WQHQCGQC 253

  Fly   354 QKAFKTSTALKDH 366
            .|.|...:.|..|
  Fly   254 GKYFSQFSYLNRH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 5/44 (11%)
C2H2 Zn finger 262..282 CDD:275368 5/42 (12%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 23/73 (32%)
C2H2 Zn finger 319..339 CDD:275368 6/23 (26%)
C2H2 Zn finger 350..370 CDD:275368 6/17 (35%)
ZnF_U1 375..407 CDD:197732
C2H2 Zn finger 378..396 CDD:275368
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 27/84 (32%)
C2H2 Zn finger 191..211 CDD:275368 6/20 (30%)
zf-H2C2_2 203..229 CDD:290200 11/26 (42%)
C2H2 Zn finger 219..244 CDD:275368 6/24 (25%)
C2H2 Zn finger 250..266 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.