DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG17801

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:425 Identity:108/425 - (25%)
Similarity:169/425 - (39%) Gaps:116/425 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNS------------------ 71
            :||:.|..|||.||......|..||.|||.|||.:|..::|..|.::                  
  Fly    29 EVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKRIQRVHNEATLRRESGLDEDLESTV 93

  Fly    72 SWFEKQGKQEDSDTETAREGGNNRLESRVDV--MPISIAQPQRRRILPQRSKKVDGVPLKTVETP 134
            |..|.:|...|.::|.:.:..|...:.:.:.  :.:::|...||.   :.....|.      |||
  Fly    94 SDIEPEGDSSDLESEESYDSENYPFDKKAEESDIDLNLAHEDRRN---EPHNPYDS------ETP 149

  Fly   135 IY-----PLV-VPEIPPADLVDPLRCEDP-----IQVKSEPQLSSDYPVESMNHEEPASEMPQVM 188
            :.     ||: .|.....:|.:.:..:.|     ||:.::.:|.:.||  |:...:|.:..|:  
  Fly   150 LIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYP--SIKVVKPLALAPE-- 210

  Fly   189 KEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAY 253
                                            |:| .||:.                  .|||. 
  Fly   211 --------------------------------DVA-AENVP------------------PAKRT- 223

  Fly   254 ALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYV 318
            |.:.:...|.:||:.|....|...|:.||.|.|.|.|..||:...|::|..||.|::|.||.|:.
  Fly   224 ARKMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFE 288

  Fly   319 CKYCGKRFDNCLKRLNHERNHKESPVHRPHV------CSTCQKAFKTSTALKDHIVVHTGEQPFH 377
            |.:|...|.....:.:|||..        |:      |..|.|.|.|.|.|..|..:|:|.:||.
  Fly   289 CNFCSATFFTSTAKSSHERIR--------HIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFD 345

  Fly   378 CELCQTFFNRRNALATHYKSKHHR------LKVEE 406
            |.:||..|.|:..|.:|:.|..|:      |:.||
  Fly   346 CVICQINFARKATLRSHFDSVAHQKRASAILESEE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 21/68 (31%)
zf-C2H2 260..282 CDD:278523 6/21 (29%)
C2H2 Zn finger 262..282 CDD:275368 6/19 (32%)
C2H2 Zn finger 290..311 CDD:275368 8/20 (40%)
COG5048 <298..>383 CDD:227381 30/90 (33%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 14/38 (37%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 20/44 (45%)
zf-C2H2 231..252 CDD:278523 6/20 (30%)
C2H2 Zn finger 232..252 CDD:275368 6/19 (32%)
zf-H2C2_2 244..269 CDD:290200 10/24 (42%)
C2H2 Zn finger 260..281 CDD:275368 8/20 (40%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C61Y
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.