DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG6813

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:411 Identity:101/411 - (24%)
Similarity:152/411 - (36%) Gaps:131/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGQEAEHAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCI-- 67
            ||.|.: ::....||......::..|..:||..|..:..:..::|.:||.:|..||.||:|||  
  Fly     6 CRICSR-SDAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCIIA 69

  Fly    68 -RTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTV 131
             :.|....|...|...:|.....:..:|::||.:|.   ||..|:           |..:|:   
  Fly    70 EKQNLERIECDSKDCSTDPIIYEDIDDNQIESELDE---SILCPE-----------VKDLPM--- 117

  Fly   132 ETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQ 196
                        |.|:.|            |.|        .|:||:                  
  Fly   118 ------------PSAEKV------------SAP--------TSLNHQ------------------ 132

  Fly   197 VIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYF 261
                                         ::|...|..                         |.
  Fly   133 -----------------------------KSIGGGTGP-------------------------YV 143

  Fly   262 CDQCGKTFSEKGNFNVHLRRHKGTKEFQC--QECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGK 324
            |..||:..:.|.||..|..||.|.|.|.|  ..|:|...|:..|..|.|| |.||.||||.||.:
  Fly   144 CPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRI-HTGEQPYVCVYCPR 207

  Fly   325 RFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRN 389
            ||.:...|..|.|.|:.   .|.:.|.||:|:|.:|..|:.|.::|...:..:|.:||..|.|.:
  Fly   208 RFSSSGARQEHHRRHRN---ERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRIS 269

  Fly   390 ALATHYKSKHHRLKVEEQSKM 410
            .|.||..|..|:.|.|:.:::
  Fly   270 HLMTHLSSNIHKRKEEKLTEL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 21/73 (29%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 8/22 (36%)
COG5048 <298..>383 CDD:227381 32/84 (38%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 12/31 (39%)
C2H2 Zn finger 378..396 CDD:275368 8/17 (47%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 21/70 (30%)
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
C2H2 Zn finger 172..194 CDD:275368 8/22 (36%)
zf-H2C2_2 186..211 CDD:290200 15/25 (60%)
UFD2 <256..>294 CDD:227443 12/35 (34%)
C2H2 Zn finger 258..280 CDD:275368 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.