DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG14711

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:432 Identity:117/432 - (27%)
Similarity:177/432 - (40%) Gaps:102/432 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCRTCGQE---AEHAKSLF---DKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAF 62
            |||.|..|   :|....||   |.:.|:::..|.::....|.....:|:.:|.||:..|..|..|
  Fly     6 LCRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHKF 70

  Fly    63 RERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVP 127
            ||.|..:..::.....|.|.....|             |.:|..:|. ....|....:..:||  
  Fly    71 RELCQESERTFATNVVKAEMKSEPT-------------DEVPHVVAD-NIEYIYESANDFIDG-- 119

  Fly   128 LKTVETPIYPLVVPEIPPAD-------------LVDPLRCEDPIQVKSEPQLSSDY-PVESMNHE 178
               ||..|....:.|.|..|             :||.|. ||.:.|.:  ...||| |:|     
  Fly   120 ---VEDDIGMENIMEEPLEDGVGETSQAYETSTVVDDLD-EDDLLVPN--STDSDYQPIE----- 173

  Fly   179 EPASEMPQVMKEEPRTLQVIGEVQKNRRKPRS------KGCLEECPG-----KDMAKIENIDSTT 232
                   :..|.:.|..::   .::.|.:||.      :...||.|.     |...::    |:|
  Fly   174 -------RCRKAKVRKTRM---TKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEV----SST 224

  Fly   233 NKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRME 297
            |                          ..|:.||..:|::...|:|:|||...|.|:|:.|.:..
  Fly   225 N--------------------------IMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSF 263

  Fly   298 FTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTA 362
            .....||.|:|: |.||.|::||||.:.|.:....:.|||.|..   .||..||||.|||..|..
  Fly   264 AGPSELNRHIRV-HTGEKPFLCKYCNRSFADRSSNIRHERTHTN---ERPFTCSTCGKAFSYSNV 324

  Fly   363 LKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKV 404
            ||:|::.||||:||.|.:|...|:|::.|..|..:..|:..|
  Fly   325 LKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 22/77 (29%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 38/84 (45%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 11/19 (58%)
ZnF_U1 375..407 CDD:197732 10/30 (33%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 22/74 (30%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
zf-H2C2_2 240..264 CDD:290200 9/23 (39%)
COG5048 249..>362 CDD:227381 46/116 (40%)
C2H2 Zn finger 256..276 CDD:275368 6/20 (30%)
zf-H2C2_2 268..292 CDD:290200 12/24 (50%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 13/24 (54%)
C2H2 Zn finger 312..332 CDD:275368 11/19 (58%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.