DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG14710

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:453 Identity:108/453 - (23%)
Similarity:175/453 - (38%) Gaps:109/453 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGQEAEHAK--SLF-DKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERC 66
            ||.|..:.|.::  .|| ||...|:...:.......:|..|.:|.:.|.||...:.....||:.|
  Fly    10 CRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFRQMC 74

  Fly    67 IRTNSSWFEKQGKQED-----SDTE-----------------------TAREGGNNRLESRVDVM 103
            :.:...|.....::.:     ||.|                       ||.|.|:.:.|.     
  Fly    75 LNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQQED----- 134

  Fly   104 PISIAQPQRRRILP------QRSKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKS 162
                   |.:.:|.      ..|.:.|..|  ..|:| ..:::..:.  ..||..:.|:.|..|.
  Fly   135 -------QSQEVLDFNGFIINESIEEDEEP--NTESP-EQILISHMD--SYVDDQQMEELIDDKG 187

  Fly   163 E--PQLSSD---YPVESMNHEEPASEMP------QVMKEEPRTLQVIGEVQKNRRKPRSKGCLEE 216
            |  .:||:.   |.||..:.|...|..|      ::.|::|             .:||......:
  Fly   188 ELVEELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKP-------------GRPRKPDAELK 239

  Fly   217 CPGKDMAKIENIDSTTNKTK---EEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVH 278
            ...||:    |.....|:.|   |||                    :.|..||..|.:|..|..|
  Fly   240 FKRKDI----NAKERGNQPKCKEEEK--------------------FMCILCGNVFYKKSVFTAH 280

  Fly   279 LRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESP 343
            :..|...|..||:.|::.......|..|:| :|.|:.||.|.||.:.|.:..:|:.|||.|..: 
  Fly   281 MMTHSEYKPHQCEICNKSFRQMGELRAHIR-RHTGDRPYKCMYCDRHFYDRSERVRHERVHTNT- 343

  Fly   344 VHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEE 406
              ||:.|..|.|.|..:..||:||:.|:.::.::|.:|...|...:.|..|.::..||.|:|:
  Fly   344 --RPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNKMEQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 19/73 (26%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 29/84 (35%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 9/32 (28%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 19/72 (26%)
COG5048 <261..395 CDD:227381 45/157 (29%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 6/22 (27%)
C2H2 Zn finger 292..312 CDD:275368 5/20 (25%)
zf-H2C2_2 304..327 CDD:290200 10/23 (43%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 335..357 CDD:290200 10/24 (42%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.