DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and M1BP

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:449 Identity:121/449 - (26%)
Similarity:190/449 - (42%) Gaps:107/449 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLCRTCGQEAEHAKS--LFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFR 63
            :.:.||.|.:.|.:.:|  ||::....::.||..|||..|.|...:|.:||..|.::|..|:..|
  Fly     9 LKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLR 73

  Fly    64 ERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPL 128
            ||||...                  ||            :.:.:.:.||:.|.......|.|..:
  Fly    74 ERCIAAQ------------------RE------------LLLGLTEEQRQGISAFYRAAVMGEDI 108

  Fly   129 -KTVETP-------IYPLVVPEIPPADLVDPLRCE----------------DPIQVKSEPQLSSD 169
             :||:||       .|..:|.| .|.:.:|..:.|                |...:..|    :|
  Fly   109 VQTVKTPDDDEVYATYQEIVLE-EPKEEIDDTKVEYDNTYYEVAEGHAGEDDAASLIEE----AD 168

  Fly   170 YPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQK-----------------NRRKPRSKGCLEEC 217
            |  :|:..|:  .|..|.::.:..|..::|:|..                 :.........:::|
  Fly   169 Y--DSIMAED--EEQQQTLELDEDTELIVGDVNDAYVYDSDDEVAVLDNVLDDEYEHENIVVKKC 229

  Fly   218 PGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRH 282
            ......|:.:.|           |.|...|.          :|.|:|||.....:..|.:|.|||
  Fly   230 SLPPKPKVRSDD-----------ARRRGTGG----------VYICEQCGNHIKGRMAFELHCRRH 273

  Fly   283 KGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRP 347
            :|.|:|.|:.|.....|...|..|:| ||.||.|:.|||||:.|.:...|:.|||.|..   .||
  Fly   274 RGDKQFGCELCQSRFCTTSELKRHMR-KHTGERPFACKYCGRCFTDYTTRVKHERTHTN---ERP 334

  Fly   348 HVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEE 406
            :||.||.|||.|...||:|:::|:||:.:.||||...|.....|:||::|..|:..:|:
  Fly   335 YVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 25/73 (34%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 40/84 (48%)
C2H2 Zn finger 319..339 CDD:275368 10/19 (53%)
C2H2 Zn finger 350..370 CDD:275368 10/19 (53%)
ZnF_U1 375..407 CDD:197732 11/32 (34%)
C2H2 Zn finger 378..396 CDD:275368 8/17 (47%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 27/100 (27%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
COG5048 276..>331 CDD:227381 24/55 (44%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
zf-H2C2_2 293..317 CDD:290200 13/24 (54%)
C2H2 Zn finger 309..329 CDD:275368 10/19 (53%)
zf-H2C2_2 324..346 CDD:290200 13/24 (54%)
C2H2 Zn finger 337..357 CDD:275368 10/19 (53%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.