DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and hb

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster


Alignment Length:304 Identity:69/304 - (22%)
Similarity:99/304 - (32%) Gaps:96/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GGNNRLESRVDVMPISIAQPQRR------RILPQRSKKVDGVPLKTVETPIYPLVVPE------- 142
            ||.|.|      .|..:..|.:.      |..||        |..|..:.|.|:.|..       
  Fly   125 GGFNPL------TPPGLPNPMQHFYGGNLRPSPQ--------PTPTSASTIAPVAVATGSSEKLQ 175

  Fly   143 --IPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNR 205
              .||.|:..|          ..|..||...:|.....:..|...:.||.               
  Fly   176 ALTPPMDVTPP----------KSPAKSSQSNIEPEKEHDQMSNSSEDMKY--------------- 215

  Fly   206 RKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFS 270
                            ||:.|:.|:..      :....|..|..|.        |.|..||....
  Fly   216 ----------------MAESEDDDTNI------RMPIYNSHGKMKN--------YKCKTCGVVAI 250

  Fly   271 EKGNFNVHLRRH-KGTKEFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKR-- 332
            .|.:|..|.|.| |..|..||.:|..:...:|.|..|:| ||:.:.|:.|..|..   .|:.:  
  Fly   251 TKVDFWAHTRTHMKPDKILQCPKCPFVTEFKHHLEYHIR-KHKNQKPFQCDKCSY---TCVNKSM 311

  Fly   333 LN-HERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQP 375
            || |.::|.....:|   |:.|..|.|...:.|.|:..: |.:|
  Fly   312 LNSHRKSHSSVYQYR---CADCDYATKYCHSFKLHLRKY-GHKP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 23/81 (28%)
C2H2 Zn finger 319..339 CDD:275368 6/22 (27%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
ZnF_U1 375..407 CDD:197732 1/1 (100%)
C2H2 Zn finger 378..396 CDD:275368
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 7/19 (37%)
C2H2 Zn finger 271..291 CDD:275368 6/20 (30%)
zf-H2C2_2 283..308 CDD:290200 9/28 (32%)
C2H2 Zn finger 299..319 CDD:275368 6/22 (27%)
C2H2 Zn finger 327..345 CDD:275368 6/17 (35%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.