DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG11247

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:328 Identity:79/328 - (24%)
Similarity:117/328 - (35%) Gaps:110/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGK-DMAK--IENIDSTTNKTKEEKYATRNKW 246
            ||:.|...:     ||..|.:....|: |.:|..|| |:.:  :.:.|...:|.|:...:.|...
  Fly    76 PQLKKSARK-----GEPVKRKHHVCSQ-CSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAV 134

  Fly   247 GAAKR-AYALEHRLYF-CDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRM-----EFTQHLL- 303
            ..... ..|.|||..| |.||.|:|:.|....:|:|.|.|.|.:.|..||:.     :..||:: 
  Fly   135 NLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVS 199

  Fly   304 ----------------------NLHVRI-KHRGELPYVCKYCGKRFDN----------------- 328
                                  ||.|.: :|...:.:.|..|..:|.|                 
  Fly   200 HHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQ 264

  Fly   329 -----CLKRL-------NHERNHKESPVH-------------------------RPHVCSTCQKA 356
                 |.|.:       .|.:.|.....|                         ||:.|..|.:.
  Fly   265 FECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQT 329

  Fly   357 FKTSTALKDHIVVHTGEQPFHCELC--QTFFNRRNALATHYKSKH--------------HRLKVE 405
            |..|:.||.||..||||:||.|:||  :..|::...|..|.|..|              .::|||
  Fly   330 FAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHDFFKIKVE 394

  Fly   406 EQS 408
            .||
  Fly   395 LQS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 9/22 (41%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 8/49 (16%)
COG5048 <298..>383 CDD:227381 34/164 (21%)
C2H2 Zn finger 319..339 CDD:275368 7/48 (15%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 13/47 (28%)
C2H2 Zn finger 378..396 CDD:275368 6/19 (32%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 39/159 (25%)
C2H2 Zn finger 95..115 CDD:275368 6/20 (30%)
zf-H2C2_2 107..132 CDD:290200 4/24 (17%)
C2H2 Zn finger 123..144 CDD:275368 2/20 (10%)
C2H2 Zn finger 152..172 CDD:275368 8/19 (42%)
zf-H2C2_2 165..189 CDD:290200 8/23 (35%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
COG5048 <192..369 CDD:227381 36/176 (20%)
C2H2 Zn finger 210..230 CDD:275370 3/19 (16%)
C2H2 Zn finger 238..260 CDD:275371 4/21 (19%)
C2H2 Zn finger 267..287 CDD:275368 3/19 (16%)
C2H2 Zn finger 295..315 CDD:275368 0/19 (0%)
zf-H2C2_2 309..332 CDD:290200 5/22 (23%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
C2H2 Zn finger 351..374 CDD:275368 7/22 (32%)
C2H2 Zn finger 382..399 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.