Sequence 1: | NP_650658.1 | Gene: | CG17806 / 42142 | FlyBaseID: | FBgn0038548 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001128128.1 | Gene: | ZNF662 / 389114 | HGNCID: | 31930 | Length: | 452 | Species: | Homo sapiens |
Alignment Length: | 224 | Identity: | 75/224 - (33%) |
---|---|---|---|
Similarity: | 100/224 - (44%) | Gaps: | 39/224 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 215 EECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAA--KRAYALEH-------RLYFCDQCGKTFS 270
Fly 271 EKGNFNVHLRRHKGTKEFQCQECDRMEFTQHL-LNLHVRIKHRGELPYVCKYCGKRFDNCLKRLN 334
Fly 335 HERNHK-ESP---------------------VH---RPHVCSTCQKAFKTSTALKDHIVVHTGEQ 374
Fly 375 PFHCELCQTFFNRRNALATHYKSKHHRLK 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17806 | NP_650658.1 | zf-AD | 4..76 | CDD:285071 | |
zf-C2H2 | 260..282 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 290..311 | CDD:275368 | 9/21 (43%) | ||
COG5048 | <298..>383 | CDD:227381 | 40/110 (36%) | ||
C2H2 Zn finger | 319..339 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 6/19 (32%) | ||
ZnF_U1 | 375..407 | CDD:197732 | 9/29 (31%) | ||
C2H2 Zn finger | 378..396 | CDD:275368 | 5/17 (29%) | ||
ZNF662 | NP_001128128.1 | KRAB | 33..92 | CDD:214630 | |
KRAB | 33..72 | CDD:279668 | |||
C2H2 Zn finger | 220..240 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 248..268 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 264..284 | CDD:290200 | 5/19 (26%) | ||
COG5048 | <272..427 | CDD:227381 | 57/156 (37%) | ||
C2H2 Zn finger | 276..296 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 288..313 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 316..341 | CDD:290200 | 15/25 (60%) | ||
C2H2 Zn finger | 332..352 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 344..367 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 360..380 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 372..395 | CDD:290200 | 7/22 (32%) | ||
C2H2 Zn finger | 388..408 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 400..425 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 416..436 | CDD:275368 | 5/20 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4733 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |