DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZKSCAN4

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_061983.2 Gene:ZKSCAN4 / 387032 HGNCID:13854 Length:545 Species:Homo sapiens


Alignment Length:447 Identity:109/447 - (24%)
Similarity:186/447 - (41%) Gaps:91/447 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCIRTNSSWFEKQGKQEDSDTETA 88
            |:.||.:.:|.|.||  ||.:.::..:..||.|...:......::   ||..:|..:...:....
Human    68 REALSRLRELCGQWL--QPEMHSKEQILELLVLEQFLTILPGNLQ---SWVREQHPESGEEVVVL 127

  Fly    89 REGGNNRLESRVDVMPISIAQPQRRRIL---------PQRSKKVDGVPLKTV-------ETPIYP 137
            .|....:|:.....:|:.   .|.:.:|         .|.|:.....|:|.:       ..|::.
Human   128 LEYLERQLDEPAPQVPVG---DQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHESLGSQPLHD 189

  Fly   138 LVVPEIP-------------PADLVDP-----LRCEDPIQVKSEP---QLSSD----YPVESM-N 176
            .|: ::|             .|..:.|     |:.|| :.:...|   ||.|.    |..|.. |
Human   190 RVL-QVPGLAQGGCCREDAMVASRLTPGSQGLLKMED-VALTLTPGWTQLDSSQVNLYRDEKQEN 252

  Fly   177 HEEPASEMPQVMKEEPRTLQVIGEVQ-KNRRKPRSKGCLEECPGK------DMAKIENIDSTTNK 234
            |....|              :.||:| |:|..|..|...|:..||      |:|:|     .|:.
Human   253 HSSLVS--------------LGGEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQI-----PTHA 298

  Fly   235 TKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFT 299
            ...|:.....:    |:..|:..|.::|.:|||:|::......|.|.|.|.|.::|::|.:....
Human   299 EAGEQEGRLQR----KQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIG 359

  Fly   300 QHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALK 364
            ...|.:|.|: |.||.||.|:.|||.|.:....:.|:|.|..   .:|:.|..|.|.|..|.:|.
Human   360 SSALVIHQRV-HTGEKPYECEECGKVFSHSSNLIKHQRTHTG---EKPYECDDCGKTFSQSCSLL 420

  Fly   365 DHIVVHTGEQPFHCELCQTFFNRRNALATHYKSKHHRLKVEEQSKMPKMDATVQADG 421
            :|..:||||:|:.|.:|...|.|.:.|.     :|.|:..::..:.|:...:.::.|
Human   421 EHHKIHTGEKPYQCNMCGKAFRRNSHLL-----RHQRIHGDKNVQNPEHGESWESQG 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 14/51 (27%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 31/84 (37%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 8/31 (26%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
ZKSCAN4NP_061983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
SCAN 49..160 CDD:128708 20/99 (20%)
KRAB 221..281 CDD:214630 20/74 (27%)
zf-C2H2 320..342 CDD:306579 7/21 (33%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
zf-H2C2_2 335..357 CDD:316026 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 5/20 (25%)
COG5048 <374..544 CDD:227381 32/107 (30%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
C2H2 Zn finger 434..454 CDD:275368 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..480 2/18 (11%)
C2H2 Zn finger 489..509 CDD:275368
C2H2 Zn finger 517..537 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.