DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZNF829

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001165450.1 Gene:ZNF829 / 374899 HGNCID:34032 Length:513 Species:Homo sapiens


Alignment Length:354 Identity:98/354 - (27%)
Similarity:154/354 - (43%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KQGKQE-DSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLV 139
            :|||:. ..|.|..| |..:.|||..:...:|:.:....:::..|         :.:.|.|.|..
Human   169 EQGKEPWMVDRELTR-GLCSDLESMCETKILSLKKRHFSQVIITR---------EDMSTFIQPTF 223

  Fly   140 VPEIPPADLVD---PLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGEV 201
            :  |||...:.   |..|:  |..|:..|.|.....:.::..|...|    .||..::......|
Human   224 L--IPPQKTMSEEKPWECK--ICGKTFNQNSQFIQHQRIHFGEKHYE----SKEYGKSFSRGSLV 280

  Fly   202 QKNRR-----KPRSKGCLEECPGKDMAKIENIDSTTNK-----TKEEKYATRNKWGAAKRAYAL- 255
            .:::|     ||      .||  |:..|..:..|..::     |.|:.|..:....|.|....| 
Human   281 TRHQRIHTGKKP------YEC--KECGKAFSCSSYFSQHQRIHTGEKPYECKECGKAFKYCSNLN 337

  Fly   256 EH-------RLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRG 313
            :|       :.|.|..|||.|::.....:|||.|.|.|.::|:||.: .||||...:..:..|.|
Human   338 DHQRIHTGEKPYECKVCGKAFTKSSQLFLHLRIHTGEKPYECKECGK-AFTQHSRLIQHQRMHTG 401

  Fly   314 ELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHC 378
            |.||.||.|||.|::.....||.|.|....::.   |..|:|||..|:.|..|..:||.|:|:.|
Human   402 EKPYECKQCGKAFNSASTLTNHHRIHAGEKLYE---CEECRKAFIQSSELIQHQRIHTDEKPYEC 463

  Fly   379 ELCQTFFNRRNALATHYKSKHHRLKVEEQ 407
            ..|...||:.:.|     ::|.|:...|:
Human   464 NECGKAFNKGSNL-----TRHQRIHTGEK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 98/354 (28%)
zf-C2H2 260..282 CDD:278523 9/21 (43%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 33/84 (39%)
C2H2 Zn finger 319..339 CDD:275368 9/19 (47%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 8/31 (26%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
ZNF829NP_001165450.1 KRAB 116..176 CDD:214630 3/6 (50%)
KRAB 116..155 CDD:279668
COG5048 <149..425 CDD:227381 76/282 (27%)
zf-C2H2 238..259 CDD:278523 5/22 (23%)
C2H2 Zn finger 239..259 CDD:275368 5/21 (24%)
C2H2 Zn finger 271..287 CDD:275368 2/15 (13%)
zf-H2C2_2 282..304 CDD:290200 7/29 (24%)
C2H2 Zn finger 295..315 CDD:275368 4/21 (19%)
zf-H2C2_2 307..332 CDD:290200 4/24 (17%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 335..359 CDD:290200 7/23 (30%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 367..388 CDD:290200 10/21 (48%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
zf-H2C2_2 392..416 CDD:290200 11/23 (48%)
C2H2 Zn finger 407..427 CDD:275368 9/19 (47%)
C2H2 Zn finger 435..455 CDD:275368 8/19 (42%)
zf-H2C2_2 447..471 CDD:290200 8/23 (35%)
C2H2 Zn finger 463..483 CDD:275368 7/24 (29%)
zf-H2C2_2 475..498 CDD:290200 4/18 (22%)
C2H2 Zn finger 491..511 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.