DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and MESR4

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:362 Identity:73/362 - (20%)
Similarity:111/362 - (30%) Gaps:121/362 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KQGKQEDSDTETARE-----------------GGNNRLE-----SRVDVMPISI-AQPQRRRILP 117
            |:.|.||.:.|...:                 .|||..|     |:|..:|:.: ....|.|.:.
  Fly   402 KEEKLEDGEVEEVEDPGEELEDPKEQSVITNHTGNNTKEEDTTASQVSALPLILPVGTTRSRSIS 466

  Fly   118 QRSKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPAS 182
            .||..|...                                   |:|.|..|:|....|.:.||.
  Fly   467 SRSSTVSSA-----------------------------------SQPHLVIDHPESEHNAKPPAL 496

  Fly   183 EMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWG 247
            ::                   :.::.|||......|.| ..|:|.....::...:...:..|   
  Fly   497 KL-------------------SLKRRRSKSSSVSQPEK-QTKVEAGGFVSSLLLQRLQSNSN--- 538

  Fly   248 AAKRAYALE-HRLYFCDQCGKTFSEK--GNFNVHLRRHKGTKE-------------FQCQECDRM 296
            ....|.:.| .::..|.:|...|..:  ...|.|..:..|.:.             |:|.:|..:
  Fly   539 VIPPAISTESQQVLSCAKCNLQFDFERFQELNKHQAQCSGIQSANSSQLSQKQERFFRCSQCCSV 603

  Fly   297 EFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLK-RLNHERNHKESPVH--------------- 345
            ....|.. ||:|..||   .|:|.||...:.:..| .|:.|..|.....|               
  Fly   604 HQCWHFF-LHMREVHR---RYICLYCNHVYPSVEKLSLHLENKHDIDQSHFAKDAWDQQQSKEDR 664

  Fly   346 -RPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELC 381
             |..||.|||..|...:..:||..... .||  |.||
  Fly   665 ARHLVCCTCQATFVQGSEFEDHDCSQL-MQP--CALC 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 73/362 (20%)
zf-C2H2 260..282 CDD:278523 5/23 (22%)
C2H2 Zn finger 262..282 CDD:275368 5/21 (24%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 29/101 (29%)
C2H2 Zn finger 319..339 CDD:275368 6/20 (30%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 4/7 (57%)
C2H2 Zn finger 378..396 CDD:275368 3/4 (75%)
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.