DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG1602

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster


Alignment Length:159 Identity:45/159 - (28%)
Similarity:74/159 - (46%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 CDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECD-----RMEFTQHLLNLHVRIKHRGELPYVCKY 321
            |..|.::|:...:..:|:|.|.|.|.:.|:.|.     |.:.|.|:..:|.:|:     .:.|..
  Fly   425 CTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIR-----AFKCTM 484

  Fly   322 CGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFN 386
            |.|.|...:...:|.:.|...   |..:||.|.|.|.:..||..|..:|:..:.|.|:||.:.|:
  Fly   485 CPKDFVKKVDLSDHIKGHLNI---RDKICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLCDSRFS 546

  Fly   387 RRNALATHYKSKHHRLKVEEQSKMPKMDA 415
            :...|.||.|..|:.|:...|.....:||
  Fly   547 QFVGLNTHMKRTHNILRNNSQKGKDAVDA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 5/19 (26%)
C2H2 Zn finger 290..311 CDD:275368 7/25 (28%)
COG5048 <298..>383 CDD:227381 24/84 (29%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 11/31 (35%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510
C2H2 Zn finger 367..388 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
COG5048 <423..554 CDD:227381 37/136 (27%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
zf-H2C2_2 437..460 CDD:290200 7/22 (32%)
C2H2 Zn finger 453..470 CDD:275368 4/16 (25%)
C2H2 Zn finger 482..502 CDD:275368 5/19 (26%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..559 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.