DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG17568

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:521 Identity:110/521 - (21%)
Similarity:175/521 - (33%) Gaps:151/521 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGQEAEH--AKSLFDKEARDVLSNIL-----KLTGFWLRNQPGVPTRICLSCLLDLNDAIAF 62
            ||.|.::..|  .|...::.::....|:|     |.....::.:..:.:.:|..|...:::.|.|
  Fly    11 CRLCAKDDAHGNVKVQMNENSQGNWDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISELIDF 75

  Fly    63 RERCIRTNSSW-----FEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKK 122
            .|...:....:     .|..|.||.......::.|....:....:.||...:.:...:..:.::.
  Fly    76 AEHVTKVQDIFEVLRRTETDGDQEMDVAALRQQFGLCDDDWTHIIKPIPALEMESDNVYQKPAEL 140

  Fly   123 VDGVPL------------KTVETPIYPL---VVPEIPPADLVD--PLRCEDPIQVKSEPQLSSDY 170
            :...||            :|..|.:...   |..|||..:.:|  |:..|     |:..||    
  Fly   141 LKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPILLE-----KNTSQL---- 196

  Fly   171 PVESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRS------KGCLEECPG---------- 219
                 :.|:...|:||....:||.        .:...|.|      ...|:.|.|          
  Fly   197 -----DMEDVLDELPQEELSQPRL--------DSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQ 248

  Fly   220 -KDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHL---- 279
             .|:..:....:|...|.|||         |||.     |: .|::|||.:..:.::..||    
  Fly   249 LMDLVAVATTPNTLESTAEEK---------AKRG-----RM-DCEKCGKVYRNRASYEKHLEREC 298

  Fly   280 ----RRHKGTK-EFQCQECDRMEFTQHLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNH 339
                ||.|..| ...|..|::...:...|.||....|:...||:|..|||:.........|:..|
  Fly   299 RRIERRVKVDKTTTTCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVH 363

  Fly   340 KESPVHRPHVCSTCQKAFKTSTALKDHI---------------------------VVHTGEQPFH 377
            .||   ||..|:.|:..||....||.|.                           ||||.|:...
  Fly   364 TES---RPFECTVCKAGFKNRARLKAHYQIHAEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLK 425

  Fly   378 CELCQTFFNRRNALATHYKS----------------------KHHRLKVEEQSKMPKMDATVQAD 420
            |::|...|.|...|.||..|                      :.|:||...|.       ..|.|
  Fly   426 CDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKHPQE-------VQQED 483

  Fly   421 G 421
            |
  Fly   484 G 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 13/82 (16%)
zf-C2H2 260..282 CDD:278523 7/29 (24%)
C2H2 Zn finger 262..282 CDD:275368 7/27 (26%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 30/111 (27%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 8/46 (17%)
ZnF_U1 375..407 CDD:197732 11/53 (21%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 13/75 (17%)
COG5048 <313..471 CDD:227381 38/160 (24%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 398..418 CDD:275368 1/19 (5%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 439..463 CDD:290200 4/23 (17%)
C2H2 Zn finger 454..475 CDD:275368 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.