DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and CG17328

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:417 Identity:91/417 - (21%)
Similarity:144/417 - (34%) Gaps:156/417 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCRTCGQEAEHAKSLFDKEARDVLSNIL----KLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRE 64
            :||.|.:|.....|::..:...:.|.:|    |:..|   ...|:|:.||.:|:..|..|..|::
  Fly     8 ICRVCLEELHPVTSIYSTDFAMMPSVMLMQCAKIRVF---KTDGLPSVICNNCIYRLGVAFHFKQ 69

  Fly    65 RCIRTN----------SSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQR 119
            .|..::          .||      ::|:.|.|                                
  Fly    70 ECENSDLRLRQYLGILESW------RQDAATNT-------------------------------- 96

  Fly   120 SKKVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEM 184
                     ..||.|:.                           ||..||               
  Fly    97 ---------DFVEKPLL---------------------------PQRDSD--------------- 110

  Fly   185 PQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAA 249
                :|||...:|.....:.:|||                            .|::..|......
  Fly   111 ----EEEPVDAKVSKRRSRYQRKP----------------------------PEEHKKRGPKPVP 143

  Fly   250 KRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGE 314
            |..:.       |.:|.|:|........|:|.|.|.|.:||..|.:....::.|.:|.| .|.|:
  Fly   144 KMPHT-------CYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHER-THTGD 200

  Fly   315 LPYVCKYCGKRFDNCLKRLNHERNHKESPVH---RPHVCSTCQKAFKTSTALKDHIVVHTGEQPF 376
            .|:.|:.|.|:|    ..|.:.:.|::  :|   |..|||.|||.|.|:..|..|::.|||.:..
  Fly   201 KPFQCEICSKQF----SALGNFQAHQK--IHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNH 259

  Fly   377 HCELCQTFFNRRNALATHYKSKHHRLK 403
            ||::|...|:||..:.|| |.|.|.|:
  Fly   260 HCDVCGKAFSRRRDMRTH-KLKLHPLE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 20/85 (24%)
zf-C2H2 260..282 CDD:278523 6/21 (29%)
C2H2 Zn finger 262..282 CDD:275368 6/19 (32%)
C2H2 Zn finger 290..311 CDD:275368 5/20 (25%)
COG5048 <298..>383 CDD:227381 30/87 (34%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 9/19 (47%)
ZnF_U1 375..407 CDD:197732 12/29 (41%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 18/74 (24%)
COG5048 146..>211 CDD:227381 20/72 (28%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 5/20 (25%)
zf-H2C2_2 189..213 CDD:404364 10/28 (36%)
C2H2 Zn finger 205..225 CDD:275368 6/25 (24%)
C2H2 Zn finger 233..253 CDD:275368 9/19 (47%)
zf-H2C2_2 245..270 CDD:404364 9/24 (38%)
C2H2 Zn finger 261..282 CDD:275368 9/21 (43%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.