DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17806 and ZSCAN22

DIOPT Version :9

Sequence 1:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001308045.1 Gene:ZSCAN22 / 342945 HGNCID:4929 Length:491 Species:Homo sapiens


Alignment Length:371 Identity:102/371 - (27%)
Similarity:143/371 - (38%) Gaps:91/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GKQEDSD-TETAR---------------EGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGV 126
            |:.|.|: |||..               ||.:.|.....::...|:.|       ....||..| 
Human   153 GESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQ-------QIHFKKTSG- 209

  Fly   127 PLKTVET--------------PIYP-LVVPEIPPA----DLVDPLRCEDPI-------------- 158
            |.|.|.|              ..:| |...|.||:    ||||....|.|.              
Human   210 PYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECR 274

  Fly   159 -QVKSEPQLSSDYPVESMNHEEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDM 222
             ..:|...|.:.....|.......||..:.........|  .:|.....||..  | :|| ||..
Human   275 KMFQSASALEAHQKTHSRKTPYACSECGKAFSRSTHLAQ--HQVVHTGAKPHE--C-KEC-GKAF 333

  Fly   223 AKIENIDSTTNKTKEEKYATRNKWGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKE 287
            :::      |:.|:.::..|..|             .|.|.:||||||...:...|.|.|.|.:.
Human   334 SRV------THLTQHQRIHTGEK-------------PYKCGECGKTFSRSTHLTQHQRVHTGERP 379

  Fly   288 FQCQECDRMEFTQ--HLLNLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVC 350
            ::|..|.: .|:|  ||.. |.|| |.||.||.|..||:.|.:|...:.|.|.|..   .:|:.|
Human   380 YECDACGK-AFSQSTHLTQ-HQRI-HTGEKPYKCDACGRAFSDCSALIRHLRIHSG---EKPYQC 438

  Fly   351 STCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNALATHYK 396
            ..|.|||..|::|.:|..:||||:|:.|..|...|:|.:||..|.:
Human   439 KVCPKAFAQSSSLIEHQRIHTGEKPYKCSDCGKAFSRSSALMVHLR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 9/19 (47%)
C2H2 Zn finger 290..311 CDD:275368 9/22 (41%)
COG5048 <298..>383 CDD:227381 36/86 (42%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 8/22 (36%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)
ZSCAN22NP_001308045.1 SCAN 45..133 CDD:307924
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..161 3/7 (43%)
COG5048 <174..482 CDD:227381 95/346 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..249 12/45 (27%)
C2H2 Zn finger 270..290 CDD:275368 2/19 (11%)
C2H2 Zn finger 298..318 CDD:275368 4/21 (19%)
C2H2 Zn finger 326..346 CDD:275368 7/27 (26%)
C2H2 Zn finger 354..374 CDD:275368 9/19 (47%)
C2H2 Zn finger 382..402 CDD:275368 9/22 (41%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368 8/19 (42%)
C2H2 Zn finger 466..486 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.